KEGG   Schizosaccharomyces pombe (fission yeast): SPAPB1A10.06c
Entry
SPAPB1A10.06c     CDS       T00076                                 

Definition
(RefSeq) putative ATP-dependent RNA helicase Dhr1
  KO
K14780  ATP-dependent RNA helicase DHX37/DHR1 [EC:3.6.4.13]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spo03009]
    SPAPB1A10.06c
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     SPAPB1A10.06c
Ribosome biogenesis [BR:spo03009]
 Eukaryotic type
  90S particles
   Helicases
    SPAPB1A10.06c
SSDB
Motif
Pfam: HA2 Helicase_C OB_NTP_bind DEAD Hormone_recep AAA_22 AAA_19 T2SSE ResIII FtsK_SpoIIIE PhoH AAA_30 AAA_33 AAA_23
Other DBs
NCBI-GeneID: 2543371
NCBI-ProteinID: NP_593520
PomBase: SPAPB1A10.06c
UniProt: Q9HDY4
Position
I:complement(join(1868252..1871515,1871563..1871850))
AA seq 1183 aa
MGRLRKRFNEKGRQSGIQKMLNLKRARLHRSVREQESSSEVHANPEPDNQDSNAEILIDV
PKEERQKRKQELKDQLLKENEGSISSKKKKRLDKYIENKLKKEEVASLIAKLAEERIDTS
LLSSSKNLGKQATAKEKLKKSLLEEKLGLPLSDADSRLYKVVDVETTTTKSSTAETNAPE
KYSTRSGFGFGFSTGTNESEITPNIKVLPPKKKKNASWGKMLNEDPEYDSAEEDYLSTDS
EEFSEDSDNSSEENKDTNEPSTKDAEKTVPEDVVNLRSEQKLQPSFGHPEFENEDFDLET
SEDDSSDDATERASRFKSWANKQILGADVGEKSHDVAPDNKIDNPDADMVRAQRMPRKLK
MREEDVEPTADDIEIKGRKTTYTIINRPPEIQESRLALPIVAEEQRIMEQIFANDVVIIC
GATGSGKTTQLPQFLFEAGFSSPESENPGMIAITQPRRVAAVSIAKRVSEELTGFSSKVS
YQIRFDSTINPDTAIKFMTDGILLRELSSDFLLTAYSAVIVDEAHERSVNTDILLGLLSR
IVRLRREMSKSDQKVKPLKLIIMSATLRVTDFSENKLLFSVPPPIIKIDARQYPVSIHFN
RTTKPDYLQDAFDKVCLIHKRLPAGSILVFLTGQQEVEQLCQMLRKRFVRSFRPLKSRAR
IVVSRKTMSVENEDLQSETEDIDQVPTSSSSSVTYDDESEPMYVLPLYSLLTTEDQMKVF
DSSPEGHRMCIVATNVAETSITIPNIRYVVDCGKAKERVYNEKTSVQKFEVRWISKANAD
QRAGRAGRTGPGHCYRLYSSAVFDSSFPLHSLPEILRTPVESIVLQMKNMNIDNIANFPF
PTSPGRSRLEKSLKLLSNLGAIDSEGVLTKLGEQMSLFPLSPRFSKMLIIGQQHGCLPYV
IALVSALSINQLFVSKQSLLYDAHDKNSRSEETDLIDDDEIKQKEEYKNRMRGYFNAISR
FQAIDPDAPALSLLSAVCAYDYASDKRKFCKENYLREKALEEVTNLRKQIIGLLKRYMVR
VEKEFFKLQLKPPTSVQIKALRQFIASAYIDQVALYDKEKRGYVTLFPSGSEVVQFVPDR
TYNIDSEYVVYLSLHESRSGRVYMSPLTEISPEHLARLAKNTTLLSYSKPLSYPPIRYLD
NATKRECWVIPILSANIGTGSPSWNLPAVQIIQKRINGRWVNC
NT seq 3552 nt   +upstreamnt  +downstreamnt
atggggagactgcgtaaaagattcaatgaaaagggacgccaaagtggcatccaaaaaatg
ctcaatttgaagcgggcgcgtttacatcgttctgtgagggagcaagaatcttcatctgag
gtgcatgccaatcctgagccagataatcaagattcgaatgccgaaatacttattgatgtt
cctaaagaagaacgtcagaaaagaaaacaagaattgaaagatcaattgttgaaggaaaac
gaaggatctatttctagtaaaaagaaaaaacgcttggataaatatatcgaaaacaagctt
aaaaaagaggaggtagcttcacttatcgcaaagttagcagaagaacgcatagacacgtct
ttactttcgagttcaaagaatttagggaagcaagccactgcaaaagagaagttaaagaaa
tcactcttggaagaaaaattgggacttccattatctgacgctgatagccgactttacaaa
gttgttgacgttgaaacgacaactacaaagagcagtacagctgaaaccaatgctccagaa
aagtattctaccagatctggttttgggtttggtttttccacaggaactaatgaaagtgag
attactcctaacattaaagtccttcctcctaaaaagaaaaaaaatgcttcttggggtaaa
atgctaaatgaagatcccgaatatgattctgctgaggaagattatttaagtacagatagt
gaggaattctcagaggattctgacaactcttcagaagagaataaagacactaacgagcct
agtactaaggatgcagaaaaaacggtgcctgaagatgtagttaatttacgctcagaacaa
aaattacaaccctcatttggacatcctgaatttgaaaatgaagattttgatttagagacc
tccgaagatgattccagtgatgacgctaccgagcgggcctctcgatttaagtcttgggca
aataaacagatccttggagcagatgttggagaaaaaagtcatgatgtggctcctgacaac
aaaattgataaccctgatgcagatatggttcgtgcccagcgcatgcctcggaaacttaaa
atgcgtgaagaggatgttgaacccacagcagacgatatcgaaataaagggacgaaaaacg
acttatactattataaatcgtcctcctgaaattcaagaaagtagattagctttacccatc
gttgctgaagagcaaaggattatggagcaaattttcgcgaatgatgttgttatcatttgt
ggtgctactggtagtggtaaaactacacaacttcctcagtttctcttcgaagcaggtttc
tcctctcctgaatcagagaatccaggaatgattgctattacacaacccagacgagttgct
gccgttagtattgccaaacgcgtttctgaagaactgactggtttttcttccaaagttagt
taccaaatcagatttgacagtacaatcaatccggataccgccattaaattcatgactgat
ggaatcttgcttcgagaattatcctctgatttccttttaactgcatactcagcagtaatt
gtagacgaagctcacgagcgaagtgtaaacacagatattctattaggtttgttaagtcga
attgttcgtttgcgaagagaaatgagcaaaagtgaccaaaaagtcaaaccccttaagctt
ataattatgtcagccacgcttcgtgttactgatttctctgaaaataaacttcttttctct
gtaccgcctccaattattaagattgatgcacgacaataccctgtttctattcactttaat
cgcacaacaaaacctgactatcttcaagatgcatttgataaagtatgcttaatacacaaa
agactcccggcaggctctatccttgtgtttctgacaggtcaacaagaagttgagcagctt
tgccaaatgttgcgaaagcggtttgtacgctcttttaggcctctaaaatctcgtgcacgc
attgtagtatcgagaaaaactatgtccgttgagaacgaggatttgcaatctgaaacagaa
gatatagatcaagtgcctacaagttcttcaagttctgtcacatatgatgatgaatctgaa
cctatgtatgtacttcctctttactctttgttaactaccgaagaccaaatgaaggtattt
gattcatcgccagaaggtcatcgtatgtgtattgtcgctaccaatgttgccgaaacatct
attaccattcctaatattcgatacgttgttgattgtggtaaggcaaaagagcgcgtgtat
aatgaaaagacttctgttcaaaaatttgaagtacgatggattagcaaagcaaatgctgat
caacgtgctggtcgtgctggtcgtacgggaccaggtcactgctatcgtctatattcgtct
gcggtgtttgatagctcttttcccttgcattctttgcctgaaattctgcgtactccggtc
gaaagcatcgtacttcaaatgaaaaacatgaacattgataacattgcaaatttccccttt
ccaacttctccaggtcgtagtaggcttgaaaaatcgttaaaactcttgtcaaatctaggg
gctattgatagcgaaggggttcttaccaaactaggagaacaaatgtccttatttcctctg
tctcctcgattttcgaaaatgttaattattggtcagcagcatggttgcctaccttatgtt
attgcattggtttcagcattgtctataaaccagctttttgtgtcaaagcaatctctttta
tatgatgctcatgacaaaaattctcgtagcgaagaaactgatctgattgatgatgacgaa
atcaagcaaaaggaagaatataaaaatagaatgcgtggatactttaatgcaatatcgaga
tttcaagctatagaccctgatgcgcctgccttgagtttgttaagtgctgtgtgtgcgtat
gactatgcttctgataagagaaagttttgtaaagagaattatctgcgagaaaaagcattg
gaagaagtcaccaatcttcgtaagcaaattattggtctactaaaaagatatatggttaga
gtcgaaaaagaatttttcaagttacagcttaagcctccaactagtgtacaaattaaagca
ctcagacaatttattgcttctgcatatattgatcaagttgctctatatgataaagagaag
cgtggatatgttacacttttcccgtctggttccgaggttgttcaattcgtacctgataga
acttataatattgattctgaatatgttgtctatcttagtctacatgaaagcagaagtggt
cgtgtttacatgtctcctttaactgaaatcagcccagaacatttggctagacttgctaaa
aatactactcttttgtcttactcgaaacccctttcatatccaccaattcggtacctggat
aatgcaacaaaacgagagtgctgggttattcctattctaagtgccaatattggaacagga
tcaccttcgtggaatctaccagccgtgcaaatcatacaaaaacggattaatgggcgttgg
gtgaattgttaa

DBGET integrated database retrieval system