KEGG   Schizosaccharomyces pombe (fission yeast): SPAPB1A11.02
Entry
SPAPB1A11.02      CDS       T00076                                 

Definition
(RefSeq) putative esterase/lipase
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Abhydrolase_3 COesterase
Other DBs
NCBI-GeneID: 2543389
NCBI-ProteinID: NP_593998
PomBase: SPAPB1A11.02
UniProt: Q9HDX3
Position
I:join(2980473..2980532,2980630..2981589)
AA seq 339 aa
MAELEFTDEKFTKVDPELKEILKKHPAGTENITNIWQMRAMDEECRKQLAETILPLPDDV
SVTDILIPTRDGTEIDGRVFTPVSVPADYRSLMVFYHSSGWCMRGVRDDDSLFKILTPKF
GCVCVSVDYRLAPESKFPVAHNDAIDSFKWVASNIEKLGANPKRGFFLGGASAGGNFVSV
LSHIARDEKIKPELTGLWHMVPTLIHPADLDEETMAQFRSYKETIHAPVITPKIMDIFFE
NYQPTPKSPLVNPLYYPTGHKDLPPSFFQCCGWDPLRDEGIAYEKALKAAGNETRLIVYE
GVPHCFWVYYPMLSLRKKYFEDAIDGFTWLLSHVKKEDD
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggcagaactcgaatttactgacgaaaaattcacaaaggttgaccctgaactaaaggag
atcctcaagaagcatcctgctggaactgaaaacattaccaacatttggcagatgcgagca
atggatgaggaatgtcgtaagcaacttgctgagacaatcttgcctcttcctgatgatgtt
tcagtcaccgatattttgattcctacacgagatggaacggaaatagatggtagggtgttt
actccagtgtcagtacctgcagattatcgttctctgatggtattctatcatagctctgga
tggtgtatgcgtggtgttcgtgatgatgactcacttttcaaaattctgactccaaagttt
ggatgcgtttgtgtttcagtcgattaccgtctagcacccgaaagcaaattccccgttgcc
cacaatgatgccattgactcctttaaatgggttgccagcaacattgaaaaactcggtgca
aatcccaaacgtggtttcttcttaggaggtgcatctgctggcggaaactttgtttccgtt
ttgagtcatatcgcgagagatgaaaagattaaaccagagctcactggtctctggcatatg
gttcctacacttattcaccctgcggatttggacgaagagactatggcacaatttagaagc
tataaagagactattcatgctccagtaatcactccaaaaatcatggatatcttcttcgaa
aactatcaaccaacccccaagtcacctttagttaatccattgtattatcccaccggtcat
aaggatcttcctccatcctttttccagtgttgtggatgggatcctcttcgtgatgaggga
attgcttacgaaaaggctctcaaagccgctggaaacgaaactcgtctcattgtatatgag
ggtgtaccacattgcttctgggtatattaccctatgttgtctttgaggaaaaaatacttt
gaagatgcaattgatggatttacctggcttttaagtcatgtaaagaaagaagatgattaa

DBGET integrated database retrieval system