KEGG   Schizosaccharomyces pombe (fission yeast): SPAPB1A11.03
Entry
SPAPB1A11.03      CDS       T00076                                 

Definition
(RefSeq) L-lactate dehydrogenase (cytochrome)
  KO
K00467  lactate 2-monooxygenase [EC:1.13.12.4]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00620  Pyruvate metabolism
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPAPB1A11.03
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.12  With incorporation of one atom of oxygen (internal monooxygenases or internal mixed-function oxidases)
    1.13.12.4  lactate 2-monooxygenase
     SPAPB1A11.03
SSDB
Motif
Pfam: FMN_dh NMO IMPDH ThiG Glu_synthase SH3_12 His_biosynth
Other DBs
NCBI-GeneID: 2543401
NCBI-ProteinID: NP_593999
PomBase: SPAPB1A11.03
UniProt: Q9HDX2
Position
I:2984786..2986009
AA seq 407 aa
MFRNYNWFDAKEPISYESEIYAKGLKFQRPQITVDGRHWEQLAVERMTKDAAGYVYGCAG
KRETYDKNMESFKKWSIIPNRLIKSGFPDLSTTVFGQKYPFPIALAPVGVQKIFNPEGES
GSCAAATREHIPYIISTASATSFEDIEKASGPGERWYQLYWPSNDHQDITISLLNRAKKT
GCRVLIVTLDTFILGWRPSDMDNGYDPFLNPDSIGVEHGFSDPVFRKQFKEKHGVEVEEN
MLEAAKEFAGIVFPGISHDWEDLKFLRKHWDGPIVLKGIMNVPDAKKAVEYGMQGIVVSN
HGGRQQDGGVASLTMLPKIVDAVGDKLDVLFDSGVRSGADIAKALALGAKMVLIGRPYVY
GLALEGSSGVSHVIRCLLGDLELTLHLSGIVSVKPKDLNRDVLYKEE
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgttccgcaactacaattggtttgacgcaaaagagcccatttcatatgagtccgaaatt
tacgctaaaggtctcaagtttcaaagaccccaaatcaccgtagatggcagacactgggag
caactggctgttgagcgaatgaccaaggatgccgccggctacgtttacggatgtgcagga
aaaagagagacatatgataaaaatatggaatcctttaagaaatggtccatcattcctaac
cgtctcatcaagtctggtttccccgacttgtctaccactgtctttggccaaaaatatcct
tttcctattgccttggctcctgtaggagtacaaaaaattttcaatccagagggtgaaagt
ggatcgtgtgccgctgcaactagagagcatataccctatattatcagtactgcgtctgca
accagctttgaagatatagaaaaggctagtggtcctggagagagatggtatcaactttat
tggccaagcaatgaccatcaagacattaccattagtttgctcaaccgcgccaagaaaacg
ggctgcagagttttgatagttactcttgacacatttattcttggatggcgtccctcagac
atggacaatggttacgatccattcttaaatcctgacagcatcggtgttgaacacggattt
tccgaccccgttttccgtaagcagtttaaggagaagcatggtgtggaagtcgaagaaaat
atgttagaggcagctaaagagtttgctggaattgtctttcctggaatcagccatgattgg
gaagacttgaagttccttcgtaaacattgggatggcccaattgttctcaaaggtatcatg
aatgttcctgatgctaagaaggcagttgaatatggcatgcagggcatcgttgtatcaaat
catggcggtagacaacaagatggaggtgttgcttccttgacgatgctaccaaagatcgta
gatgctgttggtgataaattagatgttctatttgactctggtgttcgttcaggtgctgac
attgccaaggcccttgcattaggagctaagatggttttaatcggtcgtccctatgtttac
gggttagcccttgaaggttcatccggtgttagtcatgtcattcgttgtctcttgggagat
ttggaattaacgctacatctatctggtattgtatctgtgaaaccaaaggacttaaaccgt
gatgtcttatataaggaggaataa

DBGET integrated database retrieval system