KEGG   Schizosaccharomyces pombe (fission yeast): SPAPB24D3.02cHelp
Entry
SPAPB24D3.02c     CDS       T00076                                 

Definition
(RefSeq) amino-acid permease
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease
Motif
Other DBs
NCBI-GeneID: 2543419
NCBI-ProteinID: NP_593989
PomBase: SPAPB24D3.02c
UniProt: Q9C0Z0
Position
I:complement(2950090..2951721)
Genome map
AA seq 543 aa AA seqDB search
MDETIGMKKEFHDISVGDIEVGESAPVTEDDKMLLNLGYKQEFKREFSLLAVFGQSFGSM
GLCPSLVGSMAFSMNCGAGGMVWSWFVGATCLLPIAFALSELASSMPTSGSLYFWTAYLS
PPKYRAFLSWFLGYVLALAYSTGFASTIYAAAGLVQATASVANPSYAPTKYEEYGIYVAL
SFACSALIVLPTKFLARFSSFNVVFQICTILIFIISLAASSTSETRNTGSYIFGNFENYS
GWTNMGWSFILCFTTPVWVLSGFESCATIVEEAKNASKAAPIAIISSLTVSLFMGFCIMI
TIAGTMGHDFSSILNTPYGEPVSQVLYNNLGKRGAVGVSAVLIIALCFNCSALCLASSRE
IFAFARDKGLPGSWIFRKLTPGGIPLNAILLVNLYTIIVGLLMLVNVTAISSIFNLAIIA
FFISYSLPLVCRLLFNRLNPGKFYCGKFSKPISIVAVAWLWFMALMLLFPSYQNPNKVEM
NWAIVVLGFTVFFCVGYYYLPKYGGKTFFKGPVKTVDENVTEGVTVDFQADHVSKEDDGK
SYN
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaacaattgggatgaagaaagaatttcacgatatctctgttggggacatagag
gttggtgagtctgcccccgttacagaagacgataagatgctattgaaccttggttataag
caagagtttaaacgagaattttccctactcgccgtgtttggtcagtcctttggatccatg
ggcctgtgtccttctctcgtgggctccatggcctttagtatgaattgtggcgccggaggt
atggtttggtcttggtttgtgggtgctacttgtttacttccaattgcttttgctttgagc
gagttggcatcatcaatgcccacttctggcagtttatatttttggacggcttatctctct
cctccaaagtaccgtgccttcttaagttggttcctgggatatgtacttgcactcgcatat
tctacaggatttgcctctactatctatgctgctgcgggtcttgttcaagcaacagcgtct
gttgccaatccctcgtatgctccgactaaatatgaagagtacggtatctatgtcgcttta
agttttgcctgttcagctttgattgttcttccaacaaagttccttgctcgtttcagcagt
tttaatgtggtgtttcaaatatgcacgattcttatatttattatcagtttagcagcatca
tcaacttccgagactagaaacactgggagctatatttttggaaatttcgaaaattattct
ggatggactaacatgggttggtccttcatcctttgcttcacaacccccgtttgggttttg
tcaggctttgaatcgtgtgctactattgttgaagaggccaaaaatgctagcaaagcagca
cccattgcaattatttcaagtcttacggtatctctttttatgggattttgcattatgatc
actatagcaggcacaatgggtcacgactttagttctattctaaacactccctacggagaa
ccagtttctcaggtgctttataataatcttggcaaaaggggtgcagttggcgtgtcagct
gttttgataatagctctttgttttaattgctctgcgttatgcctggcttcttctagagaa
atttttgctttcgctagagacaagggtcttcctggtagttggatattccgtaagctaact
cctggcggcattccactcaatgcgattcttcttgtcaatctctataccattattgttggc
ttgctcatgttggttaacgtgacagccatcagctctatctttaatttagctatcatcgca
ttttttatttcatattctttacctttagtatgccgtttgttgtttaatcggctgaaccct
ggaaagttttattgcgggaaatttagcaagcctatttcaattgtagccgtggcttggtta
tggttcatggcgcttatgcttcttttccctagttaccaaaatccgaataaagtggaaatg
aattgggccattgtagtgctggggttcacagtctttttctgcgtaggatattattatcta
ccaaaatacggaggtaaaacttttttcaaaggtcctgttaaaacagttgatgagaatgtt
actgaaggtgttactgtggattttcaggcagatcatgtgtccaaagaagatgatggcaag
tcttataattag

DBGET integrated database retrieval system