KEGG   Schizosaccharomyces pombe (fission yeast): SPAPB2B4.01c
Entry
SPAPB2B4.01c      CDS       T00076                                 

Gene name
gpi12
Definition
(RefSeq) putative pig-L family GPI synthesis protein
  KO
K03434  N-acetylglucosaminylphosphatidylinositol deacetylase [EC:3.5.1.89]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    SPAPB2B4.01c (gpi12)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.89  N-acetylglucosaminylphosphatidylinositol deacetylase
     SPAPB2B4.01c (gpi12)
SSDB
Motif
Pfam: PIG-L
Other DBs
NCBI-GeneID: 2543490
NCBI-ProteinID: NP_593887
PomBase: SPAPB2B4.01c
UniProt: Q9HDW9
Position
I:complement(join(2706276..2706552,2706604..2706671,2706728..2706918,2706983..2707193))
AA seq 248 aa
MIWFWSTLLVTAIAVLSTANESSSGQEKLAVESILFVFAHPDDESMFFGPTIDYLGNQHS
TRVHVLCLSNGNADGLGSVREKELVVAASKYQIDKTNVHVVSDPQLQDGMQAKWDPTDVA
KHISQIIERYNIKTLITFDNKGISGHPNHIACYEGAMKIVKATPQVQVFVLESVNIFRKY
ISYLDTIPTLVQSQAGRNDTIIIHADRKSTQRIRDAMVRGHKSQMVWFRYGWIYLSKYMS
NNVLKRAT
NT seq 747 nt   +upstreamnt  +downstreamnt
atgatttggttttggtcaactttgttagttaccgcaatagctgtattatccactgcaaat
gaatcctcttctggtcaagagaaattagcagttgaatcaatccttttcgtctttgctcat
cccgatgatgaatctatgttttttggtcccaccatcgactatttaggcaatcagcattct
actcgagttcatgttttgtgtctttctaatggcaatgccgatgggctcggaagcgttaga
gaaaaagagttggtcgtcgctgcttctaagtaccaaattgataaaaccaatgttcatgtt
gtgtcagatcctcaattgcaagacggtatgcaggcaaaatgggatccaaccgatgtagcg
aaacacatttctcaaataattgaacgttacaacattaaaacgctcattacctttgacaat
aaaggaatatccggtcacccaaaccatatcgcatgttacgaaggtgccatgaaaattgtc
aaagctactccccaagttcaagtcttcgttttagagtcggttaatatatttcgaaaatac
atctcatatttggacaccattcccactcttgtccaaagtcaggcgggtcgaaacgataca
ataatcattcacgcagatcgaaaatctactcagcgcatacgcgatgctatggtacgagga
cacaaaagtcaaatggtttggtttcgctacggctggatatacttgtctaagtatatgtct
aacaatgtattaaagcgggctacttaa

DBGET integrated database retrieval system