KEGG   Schizosaccharomyces pombe (fission yeast): SPAPB2B4.03
Entry
SPAPB2B4.03       CDS       T00076                                 

Gene name
cig2
Definition
(RefSeq) G1/S-specific B-type cyclin Cig2
  KO
K23469  G2/mitotic-specific cyclin 2
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04011  MAPK signaling pathway - yeast
spo04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:spo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    SPAPB2B4.03 (cig2)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    SPAPB2B4.03 (cig2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 2543481
NCBI-ProteinID: NP_593889
PomBase: SPAPB2B4.03
UniProt: P36630
Position
I:2711080..2712315
AA seq 411 aa
MALYSISKPVGSKINKHSYQDENTLVGKQALSKGTEKTKLSTNFEINLPRRTVLSDVSNV
GKNNADEKDTKKAKRSFDESNLSTNEEADKPVESKFVKKLKVYSKNADPSVETLQKDRVS
NVDDHLSSNPLMAEEYAPEIFEYIRKLDLKCLPNPKYMDQQKELTWKMREILNEWLVEIH
SNFCLMPETLYLAVNIIDRFLSRRSCSLSKFQLTGITALLIASKYEEVMCPSIQNFVYMT
DGAFTVEDVCVAERYMLNVLNFDLSYPSPLNFLRKISQAEGYDAQTRTLGKYLTEIYLFD
HDLLRYPMSKIAAAAMYLSRRLLRRGPWTPKLVESSGGYEEHELKEIAYIMLHYHNKPLE
HKAFFQKYSSKRFLKASIFVHQLVRQRYSVNRTDDDDLQSEPSSSLTNDGH
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggctctctattcaatttcaaagcctgttggttctaaaatcaataagcatagttatcaa
gatgaaaacacacttgttggcaaacaagctttatcaaaagggactgagaagacaaaatta
tctacaaattttgaaattaatctgccacgtcgaactgtcctatctgatgtttccaatgta
ggtaaaaataatgctgatgagaaggatacgaaaaaagcgaaaagatcgttcgatgaatct
aatttatctacaaatgaagaagctgataaacctgtcgaatctaaattcgtgaaaaagttg
aaagtttatagcaaaaatgcggatccatctgtagaaactttacaaaaggacagagtctct
aatgttgatgatcatttatcctccaatcctttgatggctgaggaatacgcacccgaaata
tttgagtacatcagaaagctggatttaaagtgtcttcccaatccaaaatatatggaccaa
caaaaagaattaacctggaaaatgagggaaattttgaatgaatggttggtggaaatacat
tccaacttttgtttaatgcccgaaaccctttatttggcagtcaatataattgatcgattc
ttgtcgcgtcgttcatgctctttgtctaaatttcaattaacaggcattactgctcttctc
atcgctagcaaatatgaggaggttatgtgtccttcgatacaaaactttgtttacatgact
gatggtgcttttaccgtagaagatgtctgtgtcgctgaacgttatatgttaaatgttctc
aattttgacttgtcctatccaagtcctttaaattttcttcgcaaaatatctcaagcagaa
ggttatgatgcacaaacaaggacattggggaaatacctaacagaaatttatctgtttgac
cacgatttattacgatatcctatgtctaaaattgctgctgccgcaatgtatttgagccgc
cgattattgcgtcgcggcccatggacgccaaagttagttgaaagctctggtgggtatgaa
gagcatgaattaaaggagatagcgtatattatgcttcattatcataacaagcctctagaa
cacaaagcctttttccaaaaatactcctcaaaaaggttcctgaaggctagtatttttgtt
catcaactcgtccgtcaacgatactcagtcaatcgtacggacgatgatgaccttcaatca
gaaccgtcttcttctttaacaaatgatggtcactaa

DBGET integrated database retrieval system