KEGG   Schizosaccharomyces pombe (fission yeast): SPAPB2B4.06
Entry
SPAPB2B4.06       CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: DUF2124
Other DBs
NCBI-GeneID: 2543466
NCBI-ProteinID: NP_593892
PomBase: SPAPB2B4.06
UniProt: Q9HDW5
Position
I:join(2722735..2723210,2723273..2723300,2723349..2723559,2723608..2723660)
AA seq 255 aa
MGIASSLRLFGKAPASYLFNGFRRQMKNPLMKKGVVYAGVSGTCAAAGYMFGNFVMEKHI
YQVKYTEEQEKEVLEVENRLQNLKIVKDLRQNPSFRELRMPFNRSNHSLTNNLLSGPGRI
TVPPVIFYDKSTRQVYAIAHVGKDVGLDDDTIHPGLIATCMDEVLAICSFLSLPNKIAVT
ANLKLSNPTKAYTNHFYILRSHLEWTKGRKAQTHGTAYMLDNEDPSKSTCVAIADGLFVE
PRFAKYLKHVIPVSL
NT seq 768 nt   +upstreamnt  +downstreamnt
atgggaattgcttcgtctcttcgtctttttggaaaagctccggcttcatatttatttaat
ggatttagaaggcaaatgaaaaatccattgatgaagaaaggagtcgtttatgccggtgtg
tcagggacttgcgcggccgctgggtatatgtttggaaattttgttatggaaaagcatatc
tatcaagtcaaatatacagaagaacaagaaaaggaagtattggaggtagaaaatcgttta
caaaacctgaaaattgtaaaagacttacgacaaaatccttcgtttcgcgagttgcgtatg
ccattcaatcgtagcaatcacagtttgacaaataaccttttgagtggtcctggacgtata
acagttcctccagtaattttttatgataaatctacacgacaagtctacgcaattgcccat
gtaggcaaagatgtcggtctcgacgatgatactatacatcctggacttattgcaacatgt
atggacgaagttctagctatatgtagcttcctgagtttgcccaacaaaattgcagtaact
gccaatctgaaactttcaaatcctacaaaagcatacacaaaccatttctatattttgcgc
tcccatcttgaatggactaagggccgaaaggctcaaacccatggtactgcttatatgttg
gacaatgaggacccttcaaaatctacgtgtgtcgcaatagcggatggattatttgtcgaa
ccgcgttttgccaaatatttaaagcatgtaatacccgtgagtctctga

DBGET integrated database retrieval system