KEGG   Schizosaccharomyces pombe (fission yeast): SPAPJ760.02c
Entry
SPAPJ760.02c      CDS       T00076                                 

Gene name
abp1
Definition
(RefSeq) cofilin/tropomyosin family protein abp1
  KO
K20520  drebrin-like protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPAPJ760.02c (abp1)
Membrane trafficking [BR:spo04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    SPAPJ760.02c (abp1)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 Cofilin_ADF
Other DBs
NCBI-GeneID: 2542979
NCBI-ProteinID: NP_594921
PomBase: SPAPJ760.02c
UniProt: Q9P7E8
Position
I:complement(join(5262392..5264817,5264883..5265030))
AA seq 857 aa
MSFQLDTSTHGAEIRNVYEKVLSGADDCSWAIFGYEKGQGNILKVVASGNDNDEFLDEFD
ENAVLFGFLRVKDVNTGLNKFVLVCWCGEAAARKGLFSIHMATVSNLLKGYHVQITGRES
SDLNMDDIIRRVADASGSKYSVHTSNSTPQSKHNAFYDASQTFGSTAKVAPAPAPSTKTP
LANISKPVVQAQKDSKDNSWDDSSKQSNTQTANTTSNLRVPVNASWSDAGRKEKSQENKP
KPTPFGSGGPSKPTPFESHGPAKQISVQPSEHPKPSISTTTTGSSYRSAESSHAPTTPDH
FKLTPLTKLEPQPPSGSPSKKPVSELEELHTAGNVNLSARRALFEKKESSTKNVENPVSH
HLKSPVRTSFPPASTTASKQDSPSTVPVDKQETAKPINKQVSSNETSAQEEPRESVAALR
ARFAKANVSENNDPPTFPKTAAKISSFNSKAGTSFAKPRPFTNNPNPISAPEKPTSGESL
SLNPPPAMPKVFPERDISSASQKAAQPSVITPSVPQPPAAPVVPEAPSVHQPPAAPVAPE
VPSAPQRPAAPVVPEAPSVPQRPAVPVVPEALSVPQPPVAPVAPEVPSVPQPPVAPVVPE
APSVPQPPVAPVAPEVPSVPQRPAVPVVPEAPSVPQPPAAPVVPEVPSVPQRPAVPVVPE
APSVPQPPAAPVVPEVPSVPQPPAVPVVPEAGQLNEPVVPPLPPHDETQEPQVGGDVKAT
EHTQPTKTPAIVIYDYSPEEENEIELVENEQIQILEFVDDGWWLGENSKGQQGLFPSNYV
EITGPNETANNPPAEPQAGGPGKSVKAIYDYQAQEDNELSFFEDEIIANVDCVDPNWWEG
ECHGHRGLFPSNYVEEI
NT seq 2574 nt   +upstreamnt  +downstreamnt
atgtcatttcaactagatacgagcacgcatggagctgagattagaaacgtttatgaaaaa
gtactcagcggtgctgatgattgctcttgggccatttttggatatgaaaaaggacaagga
aatatcttaaaagtggtggcttctggaaacgacaatgatgaatttcttgatgaatttgat
gaaaacgctgtgctgtttgggtttctacgtgtgaaggatgtcaacactggattaaataaa
tttgttttggtatgttggtgtggtgaagcagcagcccgtaaaggtttgttctctatacat
atggctacggtttccaatcttttgaaaggttatcatgttcaaataacgggacgtgagtcg
tctgatctaaatatggatgatattattcgtcgagtagcagatgctagtggtagtaaatac
tccgttcatacttctaattcaactcctcaatcaaagcataacgcattttacgatgctagc
cagacttttggaagtactgccaaggttgcccctgcaccagctccttctaccaaaacccct
ttggccaatatttcaaagccagtggtgcaagcgcagaaagactcaaaggacaatagttgg
gacgattcgtctaagcaaagcaatacccagactgcaaatactacttcaaacttacgtgtc
cctgtaaatgcatcgtggtcggatgccggtcgtaaagaaaaatctcaagaaaataagcct
aaacccactccttttgggtctggtgggccatcaaagcctactccttttgaatctcatggg
ccagctaagcaaatctctgttcagcctagcgaacacccgaagccttctatttcaactaca
actactggctcaagctatcgctctgcagaatccagtcacgctccaactactccggatcat
tttaaacttactcctttgactaaactcgaacctcaaccaccttctggttctccctcaaaa
aaacctgtctctgaattagaagagctgcataccgctggtaatgtgaatttatctgctaga
cgtgctttgttcgaaaagaaagaatcctcaactaagaatgttgaaaacccagtatcacat
catcttaaaagtcctgttcgcacaagttttcctcctgcttcaactactgccagcaaacaa
gattccccatcaacggtacctgtcgacaaacaagaaaccgccaaacctataaataaacag
gtttcatccaatgaaacttcagcacaggaagagccacgtgaaagcgttgcagcgcttcga
gctcgtttcgcaaaagcaaatgttagtgaaaataacgatcctcctacatttcccaagacg
gctgctaaaatatcgagctttaattcgaaggcaggaacttcttttgccaaacctcgacct
tttacaaataatcccaatcccataagcgctcctgaaaaaccgacatctggcgaaagtctt
tcgttaaatccacctccagcaatgccaaaggtttttccagaaagggatatctcatctgct
tcacaaaaagcggcgcaaccatcagtcattactccttcggttcctcaaccgcctgctgct
ccagttgtaccagaagctccttcggtccaccaaccgcctgctgctccagttgcacctgaa
gttccttcggcccctcagaggcctgctgctccagttgtaccagaagctccttcagttcct
cagaggcctgctgttcccgttgtaccagaagccctttcggtcccccaaccacctgttgct
cctgttgcacctgaagttccttcagttcctcaaccacctgttgctcctgttgtacctgaa
gctccttcagttcctcaaccacctgttgctcctgttgcacctgaagttccttcagttcct
cagaggcctgctgttcccgttgtaccagaagccccttcggtcccccaaccacctgctgct
cctgttgtacctgaagttccttcggtccctcagaggcctgctgttcccgttgtacctgaa
gcaccttcggtccctcaaccacctgctgcccccgttgtacctgaggttccttcagttcct
caaccccccgctgttcctgttgtaccagaagctggacaacttaatgagcccgtggttcct
cctctcccaccgcatgacgaaactcaagaacctcaagtcggtggagatgtcaaagctaca
gagcatacacaacctacaaagactccggccatagttatatatgattattctcctgaggaa
gaaaacgaaatcgagttagtagaaaatgagcagattcagattttggaatttgtcgatgat
ggatggtggttaggagaaaattctaaaggtcaacaaggtttatttccttctaactacgtt
gaaataactggacctaatgagactgccaataatcctcctgccgagccacaagcagggggt
cctggtaagtctgtgaaggcaatttatgattatcaggctcaagaagataacgagctcagc
ttttttgaagacgaaattatcgccaatgtggactgtgttgatcccaattggtgggaaggt
gagtgtcatggtcaccgaggactgtttccctcaaattatgtagaggaaatttag

DBGET integrated database retrieval system