KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1105.15c
Entry
SPBC1105.15c      CDS       T00076                                 

Gene name
htd2
Definition
(RefSeq) putative 3-hydroxyacyl-ACP dehydratase Htd2
  KO
K22541  3-hydroxyacyl-thioester dehydratase, fungi type [EC:4.2.1.-]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00061  Fatty acid biosynthesis
spo01100  Metabolic pathways
spo01212  Fatty acid metabolism
Module
spo_M00874  Fatty acid biosynthesis in mitochondria, fungi
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SPBC1105.15c (htd2)
Enzymes [BR:spo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     SPBC1105.15c (htd2)
SSDB
Motif
Pfam: MaoC_dehydratas
Other DBs
NCBI-GeneID: 2539744
NCBI-ProteinID: NP_001342895
PomBase: SPBC1105.15c
Position
II:complement(3535403..3536305)
AA seq 300 aa
MSAKVVLKDFLSQAPIDKLKATLSGHLPVSCITMDAKITSLQPGYHFLFFSLASPESNLN
SDGYESLYSPKPNNPFSFKRRIWLHGVLRFHRPLHLFQTSECHELIQEESVKSPSITKEV
EACLPKSSFLTKPTSEKQTKHVYIRRKIYDSQHQLCIEEDRTLAYLNRQELAIPKTLRSK
SIPQHSWVFTPTPIMVFRYSALMFNAHMIHWNATYATKSENYPNLVLPGPLLVTSMLEYF
RSVYPQMSKNMKRFEFRLLSPAFVNQPLRICISETGNLWIDRFTTDLDPPSLIARGRVYT
NT seq 903 nt   +upstreamnt  +downstreamnt
atgtcagcaaaggtcgttttaaaggatttcttatctcaagcgccaattgataagttaaaa
gctactttaagtggtcatttgcctgttagttgcataacaatggatgctaaaataacatca
ttacagcctggttaccattttctttttttctctttagcatctcctgaatcaaatttgaat
tcagatggatatgaaagtctttattccccaaagccaaataatcctttttcttttaagcgc
cgaatatggttacatggagtccttcgttttcatagacctttacatcttttccaaacttcg
gaatgtcatgaattgattcaggaagaatctgtgaaatctccatcaattacaaaagaagtt
gaagcttgtcttccaaaaagttcttttctaacaaagcctacttcagaaaaacagacaaag
catgtatatattcgaagaaaaatttacgacagtcagcatcaattatgtatcgaggaagat
agaacattagcctatttaaatcgacaagaactggctataccaaaaactttacgtagcaaa
agtattccacaacactcttgggtattcacacctacacctattatggtgtttcgctattca
gcattaatgtttaatgctcatatgatccattggaatgcgacatacgctacaaagtccgaa
aattatccaaatctcgttcttccaggtcctcttctagtgactagtatgttagagtacttt
cgttctgtttatccccaaatgtcaaagaacatgaaaagatttgagtttcgattattatct
cccgcgtttgtcaatcaaccactacgcatatgtatctcagagacaggtaacctatggatt
gatcgatttactacagaccttgatccaccgtctttgattgctagaggccgcgtctatacc
taa

DBGET integrated database retrieval system