KEGG   Schizosaccharomyces pombe (fission yeast): SPBC115.02c
Entry
SPBC115.02c       CDS       T00076                                 

Definition
(RefSeq) putative AFG1 family ATPase
  KO
K18798  peroxisome-assembly ATPase [EC:3.6.4.7]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:spo03029]
    SPBC115.02c
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.7  peroxisome-assembly ATPase
     SPBC115.02c
Mitochondrial biogenesis [BR:spo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SPBC115.02c
SSDB
Motif
Pfam: AFG1_ATPase AAA_16 AAA_14 Bac_DnaA AAA_5 ATPase_2 AAA AAA_7 AAA_22 TsaE RNA_helicase TniB
Other DBs
NCBI-GeneID: 2540093
NCBI-ProteinID: NP_595259
PomBase: SPBC115.02c
UniProt: O42895
Position
II:637654..639018
AA seq 454 aa
MLQVLRVSAPCFAFVDTIGSIGVCRVVRFTTFHNTPIEVYNKKVNDGVWKRDPYQETAVK
AINRLYTELESYTQPPITQDSMPAEKGSILSWISPLKKMFSRKKSPTLTSSLPVPGMPKG
IYLYGDVGCGKTALMDLFYHNLPPNVTRSQRIHFHAFMMQVHRTSHDLQDRYGFEIDFID
HIASGIAKETTVLCFDELQVTDVADALLLRRLFEALMKYGVVIFITSNRAPSDLYKNGIQ
RESFIPCIKLLEHRLQVICLDSPNDYRRLKSKTEDTYLYPANSPEVKKALENWFLCYADE
KDPAHQDEVEVFGRKIIVPKASGNVAWFTFEQLCGEPKSAADYLSLASRYHVFIVSDIPK
LSIESKDLIHRFITFIDALYDTHGKLILSSEVPVQEIYPTAPSEVLSSTADPAAKGKIES
HYHGAFGGIEEVFTFTRCLSRLSEMKKQSWIHSP
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgctgcaagtgcttcgtgtttcagctccttgttttgcttttgttgatactataggaagc
attggagtttgcagggtagttcgctttaccacatttcataatacacctattgaagtatac
aacaagaaagttaatgacggcgtatggaaacgtgacccgtatcaagaaacagcggttaaa
gcaatcaaccgtttgtataccgaattggaatcgtatacacaacctccaataacgcaagat
agtatgccagctgaaaagggatcaatcctatcttggatatcccccttaaagaaaatgttt
tctaggaagaagtctcccactctaacttcttctttacctgtaccgggtatgcctaaaggt
atatatctatatggtgatgtgggctgtggtaaaaccgctttgatggatctattttatcac
aacttaccacccaatgttactcgttctcagcgcattcatttccatgcatttatgatgcaa
gttcatcgcacttcacatgatttgcaagatcgttatgggtttgagattgattttatagat
catattgcatccggaatagcaaaagaaacaacagtgctatgttttgacgaattacaggta
accgatgtcgcggacgctcttttactacgcagactctttgaggcccttatgaagtatggt
gttgttatctttattacttctaatagggctccttctgatttgtataaaaatggaatacaa
agagagagcttcattccttgcattaaacttttggaacatcgtcttcaagtaatttgtttg
gacagtccaaacgattaccgacgcctaaaatctaaaacagaagatacatatctttatcct
gctaatagcccagaagttaagaaagccttggaaaattggtttctttgctacgctgatgag
aaagatcctgctcaccaagacgaagttgaagtatttgggagaaagataatcgttccaaaa
gcaagtggcaacgttgcatggttcacctttgaacaattatgtggagaaccgaaaagcgct
gccgactatctttcattggcaagccgttaccatgttttcatcgtttcagacattcccaaa
ttgagtatcgagtcgaaagaccttatccataggttcattacatttattgatgccctttat
gacacccatggaaaactcatcttatcatctgaagttccagttcaagaaatatatccgaca
gcaccttctgaagtactttcctctacggctgatcctgctgccaaggggaaaattgaatct
cactatcatggagcatttggtgggattgaagaggtatttaccttcacgcgttgcttgagt
agactttcagaaatgaaaaaacaatcctggattcattctccttaa

DBGET integrated database retrieval system