KEGG   Schizosaccharomyces pombe (fission yeast): SPBC119.10
Entry
SPBC119.10        CDS       T00076                                 
Symbol
asn1
Name
(RefSeq) asparagine synthetase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00250  Alanine, aspartate and glutamate metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPBC119.10 (asn1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:spo01002]
    SPBC119.10 (asn1)
Enzymes [BR:spo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     SPBC119.10 (asn1)
Peptidases and inhibitors [BR:spo01002]
 Cysteine peptidases
  Family C44
   SPBC119.10 (asn1)
SSDB
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase
Other DBs
NCBI-GeneID: 2539704
NCBI-ProteinID: NP_001342717
PomBase: SPBC119.10
Position
II:735416..737089
AA seq 557 aa
MCGILAVHHVAEDIEAFKPKALHLSKQLRHRGPDWSGKAIRNQTILCHERLAIVGVESGA
QPLVSDDGKLVLTVNGEIYNHLKLRENLKGNYKFKTYSDCEVILYLYREHGPACANMLDG
MFSWVLYDQDKDKVVAARDPIGITTLYQGFSSDSPDTAYFASELKALHPVCDKIIAFPPG
HYYDSETKQTVRYFKPSWWDENKIPSNPVDYKLLRETLEASVRKRLMAEVPYGVLLSGGL
DSSLIASIAARETEKLANSTSQSEEARTITAWPKLHSFAIGLPGSPDLLAARKVADFLHT
FHHEHTFTIDEGLDALRDVIYHLETYDVTTIRASTPMYLLSRKIKAQGVKMVLSGEGSDE
IFGGYLYFGNAPSREAFHSECVRRVKNLHLSDCLRANKSTMAWGLEARVPFLDKDFLEVA
LNIDPEEKMYINGRKEKYILRKAFDTTHDSSLQPYLPQDILWRQKEQFSDGVGYSWIDAL
KDTAELCISDDEFALPRREWGDDIPTTKEAFWYRKLFDEIFPRQCADTVMRWVPKAEWGC
PEDPSGRYQAGHVAALK
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgtgtggtattcttgctgttcatcacgtcgccgaagatattgaggctttcaagcccaag
gctcttcatttgtcgaaacaacttcgtcaccgtggtcctgactggtctggtaaggctatt
cgcaaccaaactattctttgccatgagcgtcttgctattgtcggtgttgaaagtggtgct
caacctcttgtatctgacgatggtaaacttgtccttactgtcaacggtgaaatctataac
catcttaagcttcgcgaaaacttaaagggtaactataaattcaagacttactccgattgt
gaagtcattttatatctctaccgcgaacatggtcctgcttgcgctaacatgttggacggt
atgttttcttgggttttatatgatcaagacaaggataaggttgttgctgctcgtgatccc
attggtattacaactttatatcagggcttctcatctgacagtcctgatactgcctatttt
gcttctgaattgaaggcattgcatcctgtttgcgacaaaatcattgctttccctcccgga
cattattacgactccgaaaccaagcaaactgtccgctatttcaagcctagctggtgggac
gaaaataaaattccttccaaccccgttgactacaagcttctgcgcgagactttggaggct
tccgttcgcaagcgtttaatggctgaagttccttatggtgttcttctatctggtggtttg
gattccagtttgattgcttctattgccgctcgtgaaactgagaagctcgctaacagcact
tcgcagtccgaagaggctcgtaccattaccgcttggcctaagcttcattcttttgcaatt
ggtttacctggctctcctgacttgcttgcggctcgtaaggttgccgactttttgcatact
ttccatcatgagcacaccttcactatcgatgaaggtcttgatgctcttcgtgacgttatt
taccatcttgagacatatgatgttaccactatccgtgcaagtacccccatgtatctacta
tctcgtaaaatcaaggctcaaggtgttaaaatggttttgtctggtgagggatctgacgaa
atctttggtggttatttatatttcggtaatgccccctctcgtgaggccttccattccgag
tgtgtgcgtcgtgttaagaacttgcacttatccgattgcttgcgtgctaacaagtcaact
atggcttggggtcttgaggctcgtgttcctttcttggataaggactttttggaagttgct
cttaacattgatcctgaggagaaaatgtatattaacggtcgtaaagaaaaatatattctt
cgcaaggcttttgacacaactcatgattcttcattacaaccatatctccctcaagatatt
ctttggagacagaaggaacagttctctgatggcgttggttattcatggattgacgctttg
aaggacactgctgagttatgtatttcagatgatgaatttgctcttccaaggagggaatgg
ggtgacgatattcctaccaccaaagaggcattctggtaccgcaagcttttcgacgaaatc
ttccctagacagtgtgctgacactgttatgcgttgggttcccaaggctgaatggggttgc
cccgaagatccatctggtcgttaccaggctggtcacgttgctgctttaaaataa

DBGET integrated database retrieval system