KEGG   Schizosaccharomyces pombe (fission yeast): SPBC119.15
Entry
SPBC119.15        CDS       T00076                                 

Definition
(RefSeq) GTPase npa3
  KO
K24104  GPN-loop GTPase
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:spo03021]
    SPBC119.15
Transcription machinery [BR:spo03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     SPBC119.15
SSDB
Motif
Pfam: ATP_bind_1 GTP_EFTU Arf cobW AAA_24 SRP54 MeaB AAA_30 AAA_33 AAA_18 FeoB_N Ras MMR_HSR1 AAA_22 NTPase_1 Zeta_toxin NB-ARC NACHT G-alpha AAA_16 CLP1_P Pox_A32 PduV-EutP AAA_14 SRPRB APS_kinase KTI12 AAA_7 FtsK_SpoIIIE PRK RNA_helicase Viral_helicase1 MobB DUF87 AAA_5 AAA_19 TsaE
Other DBs
NCBI-GeneID: 2540123
NCBI-ProteinID: NP_595297
PomBase: SPBC119.15
UniProt: O42906
Position
II:join(747852..747909,747984..748137,748194..749085)
AA seq 367 aa
MTDKEKKPCAIIVVGMAGSGKTTFMQQLNAHLHSKNKPPYILNLDPAVRNLPYEANIDIR
DTINYKEVMKQYNLGPNGGIMTSLNLFVTKFDQVLKILEKRAPTVDHILIDTPGQIEIFQ
WSASGSIICDTLASSWPTCIAYVVDTPRATSTSTWMSSMLYACSMLYKAKLPLIIVYNKC
DVQDSEFAKKWMTDFEEFQQAVTKDEGMSSEGATSGYMGSLVNSMSLMLEEFYRHLDFVS
CSSVTGEGMDDFLEAVKAKVKEYEEEYVPEMERMKEIQRQTKERQKEAQLSKLMKDMHVS
KDKEDVGLTVSDAEDEYNGELVDPDEDDGLTAEDREDMIKQYRVALGISDDISDEKLLEM
LTERMKQ
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgacagataaagagaagaagccttgtgccatcatagttgtaggaatggccggttcaggc
aaaaccaccttcatgcaacaactgaatgcacaccttcattcaaaaaataaacctccttac
attttaaacttggatcctgctgttcgaaatttaccctatgaggcaaatatcgatattcgt
gatacaatcaattataaagaggttatgaaacaatataacttggggccaaatggcggtatt
atgacaagtttaaacttatttgttacaaagtttgatcaagtactaaaaattttggaaaaa
cgtgcaccaacagtcgatcacattttgatagatactcctggacaaatagaaatttttcaa
tggtctgcctctggaagtatcatatgcgatacacttgccagttcttggccaacatgcatc
gcttatgttgtcgatacgccaagggcaacatctacttcaacatggatgtcatctatgctt
tatgcatgctctatgctctataaagccaagctcccacttatcattgtttataataaatgt
gatgttcaagatagcgaatttgcgaagaaatggatgaccgattttgaagagttccagcaa
gctgtgactaaagacgaaggtatgagttctgagggtgcgacatctggatatatgggttcg
ttggtaaacagtatgtctttaatgcttgaggaattttatcgtcatttagatttcgtgtcc
tgttcgtctgtgacaggtgaaggcatggatgattttttagaagctgttaaagctaaagtt
aaggagtacgaggaagaatatgttccagaaatggaacgaatgaaagaaattcaacgacag
acgaaagagagacaaaaagaagctcagctttctaaactcatgaaagacatgcatgtttct
aaagataaagaggatgttggtctaactgtttcggatgccgaagatgaatataatggcgag
ttagtggatcctgacgaagatgatggtttaactgctgaagatagagaagatatgattaag
caatatcgtgttgctcttggtatctctgacgatatctctgatgaaaagcttcttgaaatg
cttacagagcgtatgaagcaataa

DBGET integrated database retrieval system