KEGG   Schizosaccharomyces pombe (fission yeast): SPBC119.16c
Entry
SPBC119.16c       CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: DENND11 DUF4484 Afi1
Other DBs
NCBI-GeneID: 2539955
NCBI-ProteinID: NP_595298
PomBase: SPBC119.16c
UniProt: O42907
Position
II:complement(749245..750591)
AA seq 448 aa
MSIQAIVLATFDAKEGYNVENYYPGDFNVEGIEYLLFPSGIQELDNCTIFFRFQDQLCLS
VFSKLQHPSFERSAFFTSVGLILSDDINFGEAVVKYGETLLYIANGLSLATLKYKFGEDA
SETYASEKCTSHQLSDSDFFKSLQTSAVNLEFDSLFEKLQGNKFAILGANSKELSQSYAT
ILLDHLGPAFYCLYKFALQRKRILLISSHDDQLYSIIDMIVRLSSIKRSSDASIPILLSD
LHPFYSVGLANTSTLLDNDLEEGWIACTTDTVLLSKSSLYDLALYWPDNSFNANKYPQIF
NSNSIRIKPSYDDLINFKGLSRYLSFDGESSWGLTTYSLASKYIFNTSHHNLTDQEFLNE
NMLDYFQRYNQKLLTVLSSNAESFNVSDMQTLGLNPCHSLDKSFVSEISQIWLKKHINWQ
YGKYFWLRRVSLIFLASTCFLFILWKLL
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgtctattcaagccatcgtcttggcgacgtttgatgcaaaagaaggctacaacgtcgag
aattattatcctggagatttcaatgttgaaggaattgaatatttgcttttccctagtggt
atacaggagttagataattgtaccattttttttcgatttcaagaccagttatgcttaagt
gtgttttcaaaattgcaacacccctcgtttgaaaggagtgcattttttacatctgtcgga
ctcatcctcagcgatgatattaactttggtgaggctgttgtaaaatatggagaaacatta
ctctatatcgcgaatggtctgtcgttagcaactttgaaatacaaatttggggaagacgct
tctgaaacgtatgcttctgaaaagtgcacatctcaccagttatcagatagtgattttttt
aaaagtctacaaacatcagctgtgaatcttgaatttgattctctttttgagaaacttcaa
gggaacaaatttgctatcttaggtgccaattcaaaggaactctctcaatcttacgcaaca
attctgctcgatcaccttggaccggctttttattgtctttataaatttgcacttcaacgc
aagcggattcttttgatatcttctcatgatgaccaactgtattcaattatcgatatgatt
gttcgactaagctctatcaaaagatcatctgatgcttctataccaatattactttccgat
ttgcacccattctactctgttggtttggctaatactagcacattactagataatgactta
gaagagggatggattgcttgcacaactgatactgtattactttccaagtcttcactgtac
gaccttgcgttatattggcctgacaactcttttaatgctaataaatacccgcaaattttc
aactcaaattcaatccgtatcaaaccttcatatgatgacttaattaattttaagggtctt
tctaggtatctatcatttgacggggaaagtagttgggggcttactacctattctctggct
tctaaatacatttttaatacaagccatcacaatctgacagatcaggaattcttaaatgag
aatatgctggattacttccaacgttacaatcagaaattgctgaccgttttgagttcaaac
gcagagtcattcaatgtttcagacatgcaaacattaggtttgaatccatgtcattcactc
gataaatcatttgtgtcagaaatttcacaaatatggttaaaaaaacatatcaactggcaa
tacggtaaatacttttggctaaggcgggtatctctaatttttctagcatctacatgtttt
ttatttatactttggaaactattgtag

DBGET integrated database retrieval system