KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1198.02
Entry
SPBC1198.02       CDS       T00076                                 
Symbol
dea2
Name
(RefSeq) adenine deaminase Dea2
  KO
K21053  adenine deaminase [EC:3.5.4.2]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00230  Purine metabolism
spo01100  Metabolic pathways
spo01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SPBC1198.02 (dea2)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.2  adenine deaminase
     SPBC1198.02 (dea2)
SSDB
Motif
Pfam: A_deaminase AMP_deaminase Amidohydro_1
Other DBs
NCBI-GeneID: 2540066
NCBI-ProteinID: NP_595071
PomBase: SPBC1198.02
UniProt: Q9P6I7
Position
II:174842..175945
AA seq 367 aa
MSNLPIYNFIRKLPKCEHHVHLEGCLSPDLVFRLAKKNGITLPSDDAAYTTPSTLLASYE
HFGCLDDFLRYYYIAVSVLIEASDFEALAYEYFSIAHSQGVHHAEVFFDPQTHTSRGISY
DVVVSGFSAACERANRDFGMSTNLIMCFLRHLPSEAAHETFAEALKRNDFENGIVAGVGL
DSSEVDFPPELFQEVYKLAAEKGIRRTGHAGEEGDPSYIRSGLDNLSLQRIDHGIRLVED
KELMKRVAEENIMLTMCPLSNLKLRCVNSIAELPVREFLEAGVPFSINCDDPAYFGGYTL
ENYFAIQKHFNLTVKEWVFIANAAINGSWISGKRKEELLSSVQKCVKEYTAEIQQPKTLE
TAVEVQA
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgagcaatctacctatttacaatttcattagaaagctgccaaaatgcgagcatcatgtg
catttagaaggttgtctttctccagatttggtatttcgtttagctaagaaaaacgggata
actcttcctagtgatgatgctgcgtacacgactccgagtactttgttagccagctatgag
cattttggatgcttagatgacttcttacgctattattacattgctgtgtctgtgttgatt
gaggcctctgattttgaagcactcgcctatgaatatttttctatcgctcattcacaagga
gttcatcatgctgaggtctttttcgatccccaaacacatacgagccgagggatttcttac
gatgttgtagttagtggattttcagcagcttgtgagcgcgcaaatagagactttggaatg
tctactaatcttattatgtgctttctgcgtcacttgccttctgaagcagcccatgaaact
tttgcggaggcccttaaaagaaacgactttgagaatggaattgttgcaggtgtaggttta
gattcttctgaggttgattttccaccagaactgtttcaggaagtttataaattagcagcc
gaaaaaggaatccgcagaacaggacacgcaggtgaagaaggtgatccatcttatattcgt
tctggacttgataatcttagtttacaaaggattgatcatggtatccgtttagtagaagac
aaagagttaatgaagcgagttgcagaagaaaatatcatgctcaccatgtgccctctttcc
aacttaaaacttcgttgtgtcaattctattgccgagttacctgtacgggaatttttggaa
gcgggcgttccattttctattaactgcgatgatccagcttattttggcggttacaccttg
gagaactattttgctatccaaaaacattttaacttaacagttaaggaatgggtttttatt
gctaatgctgctatcaacggcagttggatatcgggcaaaagaaaagaagaattactttct
tctgttcaaaaatgtgttaaggagtatactgctgaaattcaacaacccaaaacccttgaa
acagctgtggaagttcaagcttaa

DBGET integrated database retrieval system