KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1198.14c
Entry
SPBC1198.14c      CDS       T00076                                 

Gene name
fbp1
Definition
(RefSeq) fructose-1,6-bisphosphatase Fbp1
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00010  Glycolysis / Gluconeogenesis
spo00030  Pentose phosphate pathway
spo00051  Fructose and mannose metabolism
spo00680  Methane metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPBC1198.14c (fbp1)
   00030 Pentose phosphate pathway
    SPBC1198.14c (fbp1)
   00051 Fructose and mannose metabolism
    SPBC1198.14c (fbp1)
  09102 Energy metabolism
   00680 Methane metabolism
    SPBC1198.14c (fbp1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPBC1198.14c (fbp1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SPBC1198.14c (fbp1)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPBC1198.14c (fbp1)
SSDB
Motif
Pfam: FBPase FBPase_C Inositol_P
Other DBs
NCBI-GeneID: 2540031
NCBI-ProteinID: NP_595083
PomBase: SPBC1198.14c
UniProt: P09202
Position
II:complement(198099..199142)
AA seq 347 aa
MKKDLDEIDTDIVTLSSFILQEQRRYNQKHKNEEGKPCIIQEASGELSLLLNSLQFSFKF
IANTIRKAELVNLIGLSGIVNSTGDEQKKLDKICNDIFITAMKSNGCCKLIVSEEEEDLI
VVDSNGSYAVTCDPIDGSSNIDAGVSVGTIFGIYKLRPGSQGDISDVLRPGKEMVAAGYT
MYGASAHLLLTTGHRVNGFTLDTDIGEFILTHRNMKMPLQHSIYSINEGYTAFWDEKIAR
FIAHLKESTPDKKPYSARYIGSMVADMHRTILYGGLFAYPCSKGNNGKLRLLYECFPMAF
LVEQAGGIAVNDKGDRILDLVPKTLHGKSSIWLGSKHEVEEYINFIK
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaaaaagatctcgacgaaatcgacactgacattgtcacactttcctcctttattttg
caggaacagcgccgatacaatcagaagcataaaaatgaagaaggaaaaccttgcattatt
caagaggctagtggggaattgtcattactgctaaacagtttacaattcagcttcaaattc
atcgccaacaccattcgtaaagcagagttggtaaatctcattggtttatcgggaatcgtc
aattccactggcgatgaacaaaagaagctagataaaatttgcaatgatatcttcattact
gcgatgaagtcgaacggatgctgcaaactcatcgttagtgaagaagaggaggatcttatc
gtagttgatagcaacggttcctatgccgtcacttgcgatcccatcgatggctcttccaac
attgacgccggtgttagtgtaggtaccatatttggtatctataaactgcgacccggcagt
caaggcgatattagcgatgtcttaaggcctggtaaagaaatggttgctgctggctatact
atgtatggtgcttcggctcatttattgcttaccacaggtcatcgtgtcaatggcttcacc
ttggacactgatattggcgaattcatcttgacccatcgaaacatgaaaatgcctttgcaa
catagtatttattccattaatgagggttacactgcattttgggatgaaaaaatcgctcgt
tttattgctcatctcaaagaaagcacaccagacaaaaaaccatactctgctcgatacatt
ggttctatggtcgccgatatgcaccgtaccattctttatggtgggttgtttgcttatcca
tgctcaaaaggaaataacggaaagttgagacttctttacgaatgtttccccatggccttc
cttgttgaacaagcaggaggtattgcggtaaacgacaaaggagatcgcattctggatttg
gtacccaaaacattacacggaaaaagcagtatttggcttggaagtaaacatgaagtcgag
gaatatattaatttcataaaatag

DBGET integrated database retrieval system