KEGG   Schizosaccharomyces pombe (fission yeast): SPBC11B10.02c
Entry
SPBC11B10.02c     CDS       T00076                                 

Gene name
his3
Definition
(RefSeq) bifunctional histidinol-phosphate aminotransferase/imidazole acetol phosphate transaminase His3
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00340  Histidine metabolism
spo00350  Tyrosine metabolism
spo00360  Phenylalanine metabolism
spo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01230  Biosynthesis of amino acids
Module
spo_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    SPBC11B10.02c (his3)
   00350 Tyrosine metabolism
    SPBC11B10.02c (his3)
   00360 Phenylalanine metabolism
    SPBC11B10.02c (his3)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPBC11B10.02c (his3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spo01007]
    SPBC11B10.02c (his3)
Enzymes [BR:spo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     SPBC11B10.02c (his3)
Amino acid related enzymes [BR:spo01007]
 Aminotransferase (transaminase)
  Class II
   SPBC11B10.02c (his3)
SSDB
Motif
Pfam: Aminotran_1_2 PDDEXK_7 DUF5461 Cys_Met_Meta_PP
Other DBs
NCBI-GeneID: 2539698
NCBI-ProteinID: NP_595622
PomBase: SPBC11B10.02c
UniProt: P36605
Position
II:complement(join(1488211..1488673,1488733..1489344,1489530..1489541,1489597..1489664))
AA seq 384 aa
MFDLNTCLRKNILELQPYRCARDDFSEGVLLDANECAYGSVISVDGVEFNRYPDPRQIEV
KQRLCDLRNKELSITKPLTPDNICMGVGSDEIIDSLIRISCIPGKDKILMCPPSYGMYTV
SAKINDVEVVKVLLEPDFNLNVDAICETLSKDSAIKVFFACSPGNPTAKALKLEDIKKIL
EHPTWNGIVVVDEAYIDFSAPDMSALTLVNEYPNLAVCQTLSKSFGLAGIRIGFCLTSKP
IATIMNSLKAPYNISEPTSRLALDALSPQSIDKMHTYRDAIIQQRVRLCKELTTIKGMGK
IIGGYDANFILIQVLDRPEGGKPSNDAAKYLYLQMATMHKVVVRFRGTEPLCEGALRITV
GTEEENTILLKTIKLVLQEYYTKK
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgtttgatttgaatacttgtcttcgtaaaaatatcttagaacttcagccttatcgctgt
gcgagagatgacttctctgaaggtgtccttcttgatgccaatgaatgtgcttatggttcg
gttatttccgtggacggtgtggaattcaatcgttatccggatcctagacagatcgaagta
aagcaaagattatgtgatttgagaaacaaagagctttccattaccaagccactaacacca
gataacatttgcatgggtgttggcagcgatgaaattattgactccttaattcgcatttct
tgtattcctggaaaagataagattttgatgtgtccaccttcgtacggaatgtatacggtc
tctgcaaaaatcaacgatgttgaggttgttaaggttctccttgaaccagatttcaatttg
aacgtcgatgctatttgcgaaacactttctaaagatagtgccatcaaagtcttttttgct
tgttcccctggtaatccaacagctaaggctcttaaactcgaggatattaagaagattttg
gagcaccctacatggaatggaatcgttgtcgtcgatgaggcctatattgatttctctgct
cccgatatgtctgccttaactcttgtcaatgaatatccaaaccttgctgtttgccaaacc
ctttcgaaatctttcggtctagcaggaattcgtatcggattttgtttgacaagtaaacct
attgctaccattatgaactcattaaaggctccttataacattagcgaacccacctctcgt
ttagctttggatgctttatcccctcagtcgattgataaaatgcatacatatagagatgct
attatacagcaaagagttcgtctttgcaaagagcttactaccattaaaggaatgggcaag
attataggtggttatgatgcaaattttatcctcattcaggttttagatagaccagaagga
ggtaagcctagtaacgatgccgcaaaatatctttatttacaaatggccacgatgcacaaa
gtcgttgttagatttagaggtacagagcctctttgcgaaggagcattgcgtatcactgtt
ggcacagaagaagagaatacgatattactaaaaactattaaacttgtattgcaggaatac
tatacaaaaaaatga

DBGET integrated database retrieval system