KEGG   Schizosaccharomyces pombe (fission yeast): SPBC11B10.08
Entry
SPBC11B10.08      CDS       T00076                                 

Name
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: WW
Other DBs
NCBI-GeneID: 2539874
NCBI-ProteinID: NP_595628
PomBase: SPBC11B10.08
UniProt: O13598
Position
II:1498801..1499415
AA seq 204 aa
MAYQTREGLPNGWVAQWDERYKCYFYVNESDPKAKPQWECPVRGLTIPPPPSVDHSAPPS
GPPPSYSNSAAPATPAASASSAAPAPAPAASQNRAYGAAPQPYPPQGGYPQQPYYYPNQP
NYYPAQPAYAQPVYAQPATSARRGRSGVLSNPMVTGLGGLLVGGLAMHEMDEAFDRPEEV
VYVDDNNYNNFDDYGGNDFGNDFF
NT seq 615 nt   +upstreamnt  +downstreamnt
atggcttatcaaactcgtgaaggtctccctaatggctgggtcgctcagtgggatgaacgc
tacaagtgttacttttatgttaatgaaagtgatcccaaagcaaagccgcaatgggaatgt
ccggtccgtggtttaactattccaccacctccttcggtggaccactctgctcccccaagt
ggaccgcctccttcttattccaactcagccgctcctgccactcctgccgcttctgcttct
tctgctgctcctgctcctgctcccgcagcttcccaaaacagagcatacggggccgctcca
cagccttatccccctcagggcggttatcctcaacaaccatattattatcccaatcaacca
aattattacccagcccagcctgcctacgcacaacccgtatatgcccagcctgctacttct
gcaagaagaggtcgtagcggagtcttgtctaatcccatggtgactggtttgggcggactt
cttgtcggtggtttggctatgcatgaaatggacgaagcttttgatcgtcctgaagaagtt
gtttatgtagatgataataactacaacaattttgatgattatggaggtaatgactttggc
aatgatttcttttaa

DBGET integrated database retrieval system