KEGG   Schizosaccharomyces pombe (fission yeast): SPBC11G11.01
Entry
SPBC11G11.01      CDS       T00076                                 

Gene name
fis1
Definition
(RefSeq) putative protein Fis1
  KO
K17969  mitochondrial fission 1 protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04139  Mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:spo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04139 Mitophagy - yeast
    SPBC11G11.01 (fis1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:spo03029]
    SPBC11G11.01 (fis1)
Mitochondrial biogenesis [BR:spo03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    SPBC11G11.01 (fis1)
SSDB
Motif
Pfam: Fis1_TPR_C Fis1_TPR_N TPR_6 TPR_2 TPR_14 TPR_19 TPR_1 ANAPC3 TPR_12 TPR_16
Other DBs
NCBI-GeneID: 2539939
NCBI-ProteinID: NP_595719
PomBase: SPBC11G11.01
UniProt: Q9USZ8
Position
II:join(1757807..1758188,1758302..1758402)
AA seq 160 aa
MTEKHTLRLADPSAIDSIISVDEFLQIKEQYDAEQPLITLQTKFNLAWALVRSDSTQHVQ
QGLSLFCSIYKDSPERRLECLYYIALSHYKLKQYEESRRYLNMLLSKDPNSPEALKLKNR
LYDAVTKEGYIGMVVVAGAVVSVAALVGWASKRLFSKRRP
NT seq 483 nt   +upstreamnt  +downstreamnt
atgactgaaaaacacacccttcgcctcgctgatccttctgctattgattcaattatttct
gttgatgagtttctacaaatcaaggaacaatacgatgcagaacaacctctgattacttta
caaaccaaatttaaccttgcttgggcattggtacgctcagattctacacagcatgtacaa
cagggattatctttgttctgcagcatttacaaagattcaccggaaaggcgtttggaatgc
ctctactacattgctttgtcccattacaaattgaagcagtatgaagaatcccgtcgttat
ctcaatatgttgttatccaaagatccaaatagcccagaggctttaaagctaaaaaaccgt
ctttacgatgctgttacaaaagaaggatacattggaatggttgtggtagctggtgcagtg
gtgtcagttgcagctcttgtaggttgggcatcaaaacggttgttttcaaagcgtcgtcct
taa

DBGET integrated database retrieval system