KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1289.02cHelp
Entry
SPBC1289.02c      CDS       T00076                                 

Gene name
uap2
Definition
(RefSeq) U2 snRNP-associated protein Uap2
  KO
K13093  HIV Tat-specific factor 1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:spo03041]
    SPBC1289.02c (uap2)
Spliceosome [BR:spo03041]
 Complex A
  Other components
   Complex A specific factors
    SPBC1289.02c (uap2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RRM_1 RRM_7
Motif
Other DBs
NCBI-GeneID: 2539783
NCBI-ProteinID: NP_596826
PomBase: SPBC1289.02c
UniProt: O43120
Position
II:complement(join(4384281..4384704,4384816..4385387,4385450..4385557))
Genome map
AA seq 367 aa AA seqDB search
MSSQPFWDERIHRWRCLGSEGNELIYIDEEQTWKDYDPNSLKMNKAGSTGAEVSDVTAEA
TEGKESSNGEDRHTKRLYESTSAEGYPSGSRNKKSKSENSEASPAPVINKAVYIQGLPLD
VTVDEIEEVFKKCGVIAKNIDNGTPRIKIYRTEDGTPKGDALIVFFRSESVELAEQLFDD
TEFRYGSGQKMRVQKANIDYKKEKTVNKDVGGALKKKALRLRQQQMQQISSWDDVDEEVD
DKRKKRFNKIVVLKHIFTLEELDKTPELLIDLKDDITEEAEKCGRVTNVVLYDKEPDGVV
TVRFSNNEEAEACVRLMQGRYFDGRVVEASIYDGKVRFQKSGKHTLDDEEDEEKRLEKFA
DWLENSN
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtccagccagcctttttgggatgaaagaatacatcgttggagatgtttaggatcagaa
ggaaacgaattaatatatattgatgaagaacaaacttggaaagattatgatcctaatagc
ttaaaaatgaataaggccggctcaactggtgcagaagtcagtgatgttacggcggaggct
accgaaggaaaggaatctagcaacggcgaagaccgccataccaaacgattgtacgaatcg
acatcggctgaagggtatccttcaggttctcgaaataaaaagtcaaagtccgaaaattca
gaagcctcgcccgccccagtaataaacaaagcggtttacattcaaggactaccactggat
gtcacggttgacgaaattgaagaagtattcaagaaatgcggtgttattgctaagaatatt
gacaatggtacgccgagaatcaaaatctaccggacagaggatggaactcctaaaggtgat
gctttaattgtatttttccgcagcgaaagtgttgagcttgcagagcaattatttgatgac
actgaatttcgttatggatctgggcaaaagatgcgtgtccagaaagctaatattgattac
aaaaaggagaaaacggtgaacaaagacgtaggtggtgccttaaaaaaaaaggcacttcgt
ctccgacaacaacaaatgcagcaaatttcatcctgggatgatgttgacgaagaggttgat
gataaaagaaaaaaacgatttaataaaatagtagttttaaagcatatttttacgctggaa
gaactcgataaaacacctgaacttttaattgacttaaaagacgatatcactgaggaagct
gagaaatgtggacgagttactaatgtggttttgtacgacaaggagcctgatggagtagta
actgtacggttttcaaacaatgaagaagctgaagcttgcgtaaggttaatgcaaggccga
tattttgatggccgggtagtggaagcttcaatttacgatggaaaggttcggttccagaaa
agtggaaagcatacattagatgatgaagaggacgaggaaaaacgtttggaaaaattcgca
gattggttagaaaattctaactga

DBGET integrated database retrieval system