KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1289.13cHelp
Entry
SPBC1289.13c      CDS       T00076                                 

Definition
(RefSeq) putative alpha-1,2-galactosyltransferase
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_34
Motif
Other DBs
NCBI-GeneID: 2540001
NCBI-ProteinID: NP_596837
PomBase: SPBC1289.13c
UniProt: O94622
Position
II:complement(4408061..4409188)
Genome map
AA seq 375 aa AA seqDB search
MRWYSYVIPAVILSIIAISGVWWNATLGTRLDQKVQLFLNEHSSILNAVYETTTIVYTEP
LHTSVSETITSTSFVTETTTVTPTVTATAQELSTLNPHPENSKIVLLMGSNAQNDPSSPL
NPYIRTIIKNRRDYAERHGFKFEFLDLDEYKPSIGDKPAPWAKIPMIKNVIRKYPDAEWV
WWLDHDALIMNRDLNLVDHILKHEKLNSLLLRDTEYFSGFGIDSEGFRTPKNQDPDDIHF
IIAQDFNGINAGSFLIRNSEVGTWMLDFWNEPLYKEHNGVFVEQQALSHMIYSHPIVHKH
VGLVTLRSINAYDSSDPAWGYEDGDLCVHFAGCFVFQTCAQNFEKYGKIITEKQGHDWFD
PSEKEYIEQRLFPQP
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcgttggtattcttatgttataccagcagtgatcctcagcataattgctatttctgga
gtatggtggaatgctacccttggtactaggctcgaccagaaagtacaacttttcttaaat
gaacattcttcaattttgaatgcagtttacgaaacaactactatcgtttacacagagcca
ttacacaccagtgtcagcgaaacgattacatctacgtcttttgttacagaaactacgaca
gtaaccccaacggttactgccacagctcaagagttaagcacacttaatcctcatcctgaa
aattctaagatagtccttttgatgggttccaatgcccaaaatgacccttcctcaccctta
aatccttatattagaacgattattaaaaatcgccgcgactatgcagaacgtcatggtttt
aagtttgaatttttagatttagatgagtacaaaccttcaattggcgacaagcctgcccct
tgggctaaaattcccatgattaaaaatgtgattagaaaatatccagatgctgaatgggta
tggtggttggatcacgatgctttaattatgaatcgtgatttgaatctggttgatcacatt
ttgaagcatgaaaagctaaattctcttttattgcgcgacaccgaatattttagtggattt
ggcattgactctgaaggattccgaacacctaaaaatcaagaccctgatgatatacatttt
atcattgctcaagattttaatggcattaatgctggcagttttttaataaggaattctgaa
gtaggaacatggatgctggatttttggaatgaaccactttataaagaacataatggtgta
tttgtcgaacaacaagccctttctcatatgatatatagtcatcccattgtgcataaacat
gttgggctagttactcttcgttcaataaacgcatatgattcttctgatcctgcttgggga
tatgaagacggtgatttatgtgttcattttgctgggtgctttgtctttcagacatgtgca
caaaattttgaaaagtatggcaagattatcacagaaaagcaaggccatgattggttcgat
ccatccgaaaaggaatatattgaacaacgccttttccctcaaccttaa

DBGET integrated database retrieval system