KEGG   Schizosaccharomyces pombe (fission yeast): SPBC12C2.13c
Entry
SPBC12C2.13c      CDS       T00076                                 

Gene name
fnx1
Definition
(RefSeq) vacuolar membrane amino acid uptake transporter Fnx1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: MFS_1 Sugar_tr TRI12
Other DBs
NCBI-GeneID: 2539786
NCBI-ProteinID: NP_596009
PomBase: SPBC12C2.13c
UniProt: Q09752
Position
II:2444329..2445924
AA seq 531 aa
MVDQVNLATEQTSLLYPEVSRKKEELSVNKWTILPALWVGGFLSALDMTIVASLYPVIGS
EFKLMNNASYIVTAYLITNTAFQPLYGRLSDIFGRRPTVVFANAAFTLGTFWCGISRSLP
ELCMARALAGIGGGGLGTMSSIISSDIVSLRERGTWQGITNIVWGIGGSLGGPLGGLIAQ
RWGWRTAFHFQVPMGILSTILVAWRVRVKPTVRNSNASLLSRIDYLGSFLLVTGITALVV
TFNMGGDAFPWVSPVIITLLVSSVLILFAFYWVEKNIAVEPIAPVEILSQPTPLNVCLGN
FFNAFCSFVIVYELPLFFETTLLMPSSEAGVRIFPYVISTSVGSLCSGLYMKKTGRYRNL
VIAGFFFMLMGIVSFAVLTSFGHRTPLILISLCLAMTGCSYGMNLTSTLIAIISSLAPEE
QAVATGLSYLFRATGSVIGISLSQTTTLSILMKQLASNLKDDPDKDDLIRRLRESISIIP
NLPKDIQKLVIKSYATAFTWTFALVAIIAFAGFWCSLRIKQFYLHTSVDRS
NT seq 1596 nt   +upstreamnt  +downstreamnt
atggtcgatcaggtaaatttggcgacagagcaaacttccttgctatatcctgaagtgtct
cgcaaaaaggaagagttgagtgtaaataaatggactattctacctgctttatgggttggt
ggcttcttgtctgctttggatatgacaattgttgcaagtttataccctgtaattggtagt
gaattcaagttaatgaataatgcttcctacattgttaccgcctatttaattacaaacacc
gctttccaacctttatatggtagacttagtgacatctttggacgacgccctaccgttgta
tttgcaaatgctgctttcacgcttggaactttttggtgtggtatatcgagaagtcttccg
gaattgtgtatggctcgcgctctcgccggcattggcggtggaggtcttggtaccatgtct
tccatcatttcgagtgacatcgtttcattgcgtgaacgtggtacctggcaaggtataact
aacattgtttggggtatcggaggtagtttgggaggaccattgggtgggttaattgctcaa
agatggggttggagaacagcgtttcattttcaagtccctatgggaatattatccaccata
ctagttgcttggcgtgtccgcgttaaacctaccgttcgaaattccaatgcatcgttgctt
tcacgcattgattacttaggcagttttcttcttgtaacgggcattacggcactggtagtt
acctttaacatgggcggggacgcatttccttgggtttctccagttatcattactttgctt
gtatcttctgtccttattttgttcgcattttactgggtcgaaaagaatattgctgttgaa
ccaattgcgcctgtggagatcctatctcagcctactcccttgaatgtctgtttgggtaac
tttttcaatgcgttttgcagttttgtcattgtctacgaattacccttatttttcgaaacg
acgctattaatgccatcgtctgaggccggtgttcgtatctttccttacgttatctccaca
tctgttggatctctttgttcaggcttatacatgaagaaaactggcaggtatagaaatttg
gttattgctggattttttttcatgttgatgggtattgtttcctttgctgttcttacttct
ttcggtcacagaacacccttaatattaatttctctctgtttggcaatgaccggatgttct
tatggaatgaacctaacttctacccttattgctattatcagttctttagccccagaagaa
caagctgttgctacaggcctttcctatcttttccgtgcaacaggtagcgtcattggtatc
agtctttcccaaacaacaactctttcaatccttatgaagcagttagcctccaacttaaag
gacgatccggataaagatgatttgattcgacgtcttcgagaaagtataagcatcattcca
aatctccccaaagatatccaaaagctagtcataaagtcgtatgccactgctttcacatgg
acttttgccttagttgcaattatagcttttgctggattctggtgctcgctgaggatcaaa
cagttttatttacatacctctgttgatcgttcataa

DBGET integrated database retrieval system