KEGG   Schizosaccharomyces pombe (fission yeast): SPBC12D12.02c
Entry
SPBC12D12.02c     CDS       T00076                                 
Symbol
cdm1
Name
(RefSeq) DNA polymerase delta subunit Cdm1
  KO
K03505  DNA polymerase delta subunit 4
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03030  DNA replication
spo03410  Base excision repair
spo03420  Nucleotide excision repair
spo03430  Mismatch repair
spo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SPBC12D12.02c (cdm1)
   03410 Base excision repair
    SPBC12D12.02c (cdm1)
   03420 Nucleotide excision repair
    SPBC12D12.02c (cdm1)
   03430 Mismatch repair
    SPBC12D12.02c (cdm1)
   03440 Homologous recombination
    SPBC12D12.02c (cdm1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spo03032]
    SPBC12D12.02c (cdm1)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPBC12D12.02c (cdm1)
DNA replication proteins [BR:spo03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    SPBC12D12.02c (cdm1)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      SPBC12D12.02c (cdm1)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     SPBC12D12.02c (cdm1)
SSDB
Motif
Pfam: DNA_pol_delta_4
Other DBs
NCBI-GeneID: 2540008
NCBI-ProteinID: NP_595948
PomBase: SPBC12D12.02c
Ensembl: SPBC12D12.02c
UniProt: O59835
Position
II:complement(2305691..2306339)
AA seq 160 aa
MKKRTTQAKKSGQNTNIRDVFPHVVRSNSSQSHIGKKVSSEQSPTPDVTITTKTLDERIK
EDDELSKEVEEAWNQIMAERISEPIHCENITKVEFILHHFDTTARYGPYLGMTRMQRWKR
AKNFNLNPPETVGKILMLEEADEENRKRESLFYDLQTIPG
NT seq 483 nt   +upstreamnt  +downstreamnt
atgaagaagcgcactactcaagcgaaaaaatcagggcaaaacactaatattcgcgacgtg
tttccacatgtagttcgaagtaattcaagtcaatcccacatagggaagaaagtgagttct
gaacagtcgcctacacccgatgttacaattacaaccaaaaccttggatgagagaattaaa
gaagacgatgagctttcaaaagaggtagaagaggcttggaatcaaattatggctgaaagg
attagtgaaccaatacattgtgaaaatataaccaaagtagagttcattttgcatcacttt
gacactacggcaagatatggaccatatcttggtatgacaaggatgcaacgctggaaacgt
gcaaaaaacttcaatttaaatcctccagaaacagtgggaaagatattgatgctcgaggaa
gcagatgaggaaaatcgaaaaagagaatcgctcttttatgatcttcaaaccattccaggc
tag

DBGET integrated database retrieval system