KEGG   Schizosaccharomyces pombe (fission yeast): SPBC12D12.04c
Entry
SPBC12D12.04c     CDS       T00076                                 

Gene name
pck2
Definition
(RefSeq) protein kinase C (PKC)-like Pck2
  KO
K18050  novel protein kinase C epsilon type [EC:2.7.11.13]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spo01001]
    SPBC12D12.04c (pck2)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     SPBC12D12.04c (pck2)
Protein kinases [BR:spo01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   SPBC12D12.04c (pck2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr HR1 C1_1 Pkinase_C Kinase-like C2
Other DBs
NCBI-GeneID: 2539649
NCBI-ProteinID: NP_595950
PomBase: SPBC12D12.04c
UniProt: P36583
Position
II:complement(2309787..2312837)
AA seq 1016 aa
MDMIDEAITEVVRKIERERSVIHGALSMKRLTQNQTVHQQLHSNIEESKKSIIYLEERLE
KLKLRKNGVRKSNSEKPSVGIEKNPSFSTTKSAKSFSSTSSNIDSNLDLLNYDTPLTISK
ISFLLQQLEFKLSVEEQYRKGIEKMAKLYEREHDRRSIAEAEKKYVESAQKITLLKQALK
RYHDLHIEIDEEDVPSTESRGNLNARRPQSGLLKITVGSLRNVTHSAGISKQTEMIVAIR
AEDLERARTRPSRTDRFNETFEIDLEKTNEVEIVVYEKKNEKLLLPVGLLWIRLSDLVEK
QRRKKVEQEVSDKGWVSADKMINQRLSIFLPSALNNISKPESTDRPNTASGNQSVSAWFS
LEPMGQINLTMNFTKHNTRKRPMDAGLGRQGAIRQRKESVHEVYGHKFLQHQFYQIMRCA
LCGEFLKNAAGMQCIDCHYTCHKKCYPKVVTKCISKSSDSASSEYEKINHRIPHHFESHT
NIGANWCCHCGYILPLGRKTARKCTECGITAHAQCVHLVPDFCGMSMEMANRVISEIRTT
KIYKAQQHKQKSSHHKHHHHKKSKSSSSKHKENDKASVSITTTTTPSITPADPVPTSPKP
LAIEPVKRKPVHAGNLEVTSVSDNKLGATVQVVEQKVDDKADALTKPPSLDAVKEPIPVP
SVETSVVAQDLTHKAKRIGLEDFTFLSVLGKGNFGKVMLAELKSEKQLYAIKVLKKEFIL
ENDEVESTKSEKRVFLVANRERHPFLVNLHSCFQTETRIYFVMDFVSGGDLMLHIQQEQF
SRRRAQFYAAEVCLALKYFHDNGIIYRDLKLDNILLSPDGHVKVADYGLCKEDMWHDNTT
ATFCGTPEFMAPEILLEQQYTRSVDWWAFGVLIYQMLLGQSPFRGEDEEEIFDAILSDEP
LYPIHMPRDSVSILQQLLTRDPKKRLGSGPNDAEDVMTHPFFSNINWDDIYHKRTQPPYI
PSLNSPTDTKYFDEEFTRELPVLTPVNSILTKEMQQHFEGFSYSCEDDKPSTTDNA
NT seq 3051 nt   +upstreamnt  +downstreamnt
atggatatgattgatgaggctataacagaagttgttaggaaaattgaaagagaaagatca
gttattcatggcgccctttccatgaagcgcttgactcagaatcagacagttcaccaacaa
cttcatagcaatattgaagaatcaaaaaagagcattatttatttagaagaacgcttagaa
aaactaaagcttcgcaaaaatggtgtccgaaagagtaattctgagaaaccgtccgttggc
attgagaagaatccatcctttagcactacaaaatccgctaaaagcttttcctctacttct
tctaatatcgattctaacttggatttgctaaattatgatacccctcttactatttcaaag
atatcattcttattacaacaattggagttcaaattatctgttgaggaacaatatcgaaaa
ggtattgaaaagatggcaaagctctatgagcgtgaacatgaccgtcgtagtatagctgaa
gcagagaagaagtatgtagaaagtgctcaaaagattaccttactcaagcaagctttgaag
cgataccatgacttgcatatcgaaatcgatgaggaagatgttcccagtacggaaagtaga
ggtaacttaaatgcccgtcgtccccagtctggtctccttaaaattaccgtaggatctcta
aggaacgtcacgcattctgctggaatctccaagcaaacggaaatgatagttgcaattcgt
gcagaggatcttgagcgtgcacgtactcgtccaagccgcaccgaccgttttaatgaaact
tttgaaattgatctggagaagactaatgaggtcgaaatagttgtttacgaaaagaaaaat
gaaaaattgctattacctgttggtttactttggatacggttatcggatttagtagaaaaa
caaaggcgaaaaaaggttgaacaagaggtttcagataaaggttgggttagtgccgacaaa
atgattaatcaaagactttcaatatttttaccttctgctcttaataatatttcaaagcct
gaaagtactgaccgccccaacacagctagcggtaatcaaagtgtgagtgcttggttttct
cttgaacccatgggacaaattaatttgaccatgaatttcacaaagcataatacaaggaag
agacctatggatgctggcctcggtcgtcaaggtgctatccgtcaacgcaaggaaagcgta
cacgaagtttatggtcacaaatttctacaacatcaattttatcaaattatgcgttgtgct
ttatgtggagagtttttgaagaatgctgctggtatgcagtgcattgattgtcattacacc
tgtcataaaaaatgctatccaaaggtagttactaaatgcatttcaaagtctagcgattct
gcttctagcgaatacgagaaaatcaaccatagaattcctcatcattttgaatctcacaca
aacataggtgctaattggtgctgtcactgtggctacatccttcctttaggaagaaaaact
gccaggaaatgtacggagtgtggaataactgcgcacgctcagtgtgttcatcttgttccg
gatttctgtggtatgtctatggagatggctaaccgggttatttctgagattcgtacaact
aaaatttataaagctcaacaacataaacagaaaagttcacatcacaagcatcatcatcat
aaaaagtctaagtcttcatcttcgaaacataaggaaaatgacaaagcatccgtttctatt
acaaccaccacaacaccatctatcactcctgcagaccctgttccaacttctccaaaacca
ctggcaattgaaccggttaaaagaaagcctgtacatgccggtaatttagaagtgacatca
gtctctgataataaacttggcgctacagttcaggttgtcgagcagaaagtggatgacaaa
gctgatgcgttgacgaaacctccttccctagatgctgtgaaagagccaatcccagtacca
tcagttgaaacctctgttgttgctcaagacctaacgcataaagctaagcgtatcggactt
gaagactttactttcttatctgtgctaggcaaaggaaatttcggtaaagtaatgctggct
gagcttaaaagtgaaaagcaattgtatgctattaaagttttgaaaaaggaattcatctta
gaaaacgatgaagtcgaaagcactaaatccgaaaaacgcgtttttctcgttgccaaccga
gagcgtcatccatttttggtaaacctgcattcttgctttcaaaccgaaacccgtatttac
tttgtcatggattttgtgagtggtggtgatttgatgcttcacattcaacaggaacaattt
tcacgtagaagggcacagttttatgctgctgaggtgtgtcttgctctaaaatactttcat
gataacggtatcatataccgtgatcttaagcttgataatatccttttaagcccagatggt
catgttaaagtggccgattatggtttgtgtaaggaagacatgtggcatgataacactact
gccacgttttgcggtactcctgaatttatggcaccggaaatcttattagaacagcaatat
acgagaagcgttgactggtgggcttttggtgtactaatttaccaaatgctgcttggtcaa
tctccatttagaggagaagacgaagaagaaatttttgatgcaattttatctgatgaacct
ttgtatcctattcatatgccaagggattccgtttctatattacaacaacttttgactcgc
gatcctaaaaaacgacttggatctggccctaacgatgcagaagatgtcatgactcatcca
ttttttagtaacattaattgggatgacatctatcataagcgaactcaaccaccgtacatt
ccaagtttgaattcacctacggacaccaagtatttcgatgaggaatttacccgagaactc
ccagttcttactcctgttaattctattctgacgaaagagatgcagcaacattttgaaggt
ttttcttattcatgcgaggatgataaaccctcgactaccgataatgcttag

DBGET integrated database retrieval system