KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1347.02
Entry
SPBC1347.02       CDS       T00076                                 

Gene name
fkbp39
Definition
(RefSeq) putative FKBP-type peptidyl-prolyl cis-trans isomerase
  KO
K14826  FK506-binding nuclear protein [EC:5.2.1.8]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spo03009]
    SPBC1347.02 (fkbp39)
Enzymes [BR:spo01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     SPBC1347.02 (fkbp39)
Ribosome biogenesis [BR:spo03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    SPBC1347.02 (fkbp39)
SSDB
Motif
Pfam: FKBP_C NPL Velvet XRCC4 TFIIF_alpha YL1 PCM1_C UCMA CDC45
Other DBs
NCBI-GeneID: 2539812
NCBI-ProteinID: NP_596694
PomBase: SPBC1347.02
UniProt: O74191
Position
II:4064557..4065642
AA seq 361 aa
MSLPIAVYSLSVKGKDVPAVEESTDASIHLTMASIDAGEKSNKPTTLLVKVRPRIPVEDE
DDEELDEQMQELLEESQREFVLCTLKPGSLYQQPLNLTITPGDEVFFSASGDATIHLSGN
FLVDEEDEEEEESDEDYDLSPTEEDLVETVSGDEESEEESESEDNSASEEDELDSAPAKK
AQVKKKRTKDESEQEEAASPKKNNTKKQKVEGTPVKEKKVAFAEKLEQGPTGPAAKKEKQ
QASSNAPSSPKTRTLKGGVVVTDVKTGSGASATNGKKVEMRYIGKLENGKVFDKNTKGKP
FAFILGRGEVIRGWDVGVAGMQEGGERKITIPAPMAYGNQSIPGIPKNSTLVFEVKLVRV
H
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgtctcttccaattgctgtttatagtctttcggtaaagggaaaagatgttcccgctgtg
gaggaatctacagatgcatctattcatttgactatggcatccattgatgccggcgaaaag
tctaataaaccaactactttattggtgaaggttcgtccccgtatccccgttgaagatgaa
gatgacgaagaacttgacgaacaaatgcaagagcttctggaagaaagccagcgtgaattt
gttttatgtactttgaagcctggttccttataccaacagcctttaaatttgaccattact
cctggcgacgaagtcttcttcagtgcatctggcgatgcaaccatccacttgtctggtaac
tttttggttgacgaagaagatgaggaagaggaagaatctgacgaggattacgatttgtct
cctactgaggaggatcttgtcgagactgtcagcggtgatgaggaaagtgaagaggaatct
gagtcggaagataattcagcatctgaggaggatgaattggattcagctcctgctaaaaag
gcacaggttaaaaaaaaacgtactaaggatgaatccgagcaagaagaggctgcttctcct
aagaaaaacaataccaagaagcaaaaggttgagggtacccctgttaaggaaaagaaggtt
gcatttgccgaaaaacttgaacaaggacctactggtcccgctgctaagaaagaaaagcaa
caagcttcttctaatgcaccttctagtcccaagactcgtactttaaaaggaggcgtggtt
gtaactgatgttaaaactgggagcggtgcgtctgctaccaatgggaaaaaagttgaaatg
agatatattgggaagctcgaaaatggaaaggtttttgacaaaaacactaaaggtaaaccc
tttgcttttatccttggtcgtggtgaggttattcgcgggtgggacgtcggcgttgctgga
atgcaagaaggcggtgagcgtaagattacaattcctgctcccatggcttacggcaaccag
agcattccaggaattcccaagaattctaccttagtttttgaagtcaagcttgttcgcgtt
cactaa

DBGET integrated database retrieval system