KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1347.12Help
Entry
SPBC1347.12       CDS       T00076                                 

Gene name
arp1
Definition
(RefSeq) putative centractin family actin-like protein Arp1
  KO
K16575  centractin
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPBC1347.12 (arp1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:spo04812]
    SPBC1347.12 (arp1)
   04147 Exosome [BR:spo04147]
    SPBC1347.12 (arp1)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     SPBC1347.12 (arp1)
Cytoskeleton proteins [BR:spo04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actin-related proteins
     SPBC1347.12 (arp1)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SPBC1347.12 (arp1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 2539676
NCBI-ProteinID: NP_596704
PomBase: SPBC1347.12
UniProt: O94630
Position
II:join(4083937..4083953,4083997..4084027,4084097..4084161,4084201..4085227)
Genome map
AA seq 379 aa AA seqDB search
MTVTEIFDNQPICIDNGSGFIKAGFAGDDIPKCLFPTCVGRIKHERVMPSSIQKDMFVGS
EAQNLRGLLKIQRPIERGIIQNWSDMEEIWSYIYSDQQLNTLPEEHPLLLTEPPLANIRN
KEKIAEYFYETLNVPALSFSLQPVLALYASARTTGIVLECGDGLTHSVPIYDGFSIPSAI
QQEEIGGRDVTDYLQLQLRKSGHELVSSAEKEIVREIKEKCCYVASDFRSEIESWTEHKP
QIHTYQLPDNQTITLGTECFSAPEVLFNPEMMGSEASGLHIQLFKSILLSDIDLRSTLYS
NIVLSGGSTLLRGFGERFISELRAISGKKNQVKIYASPERMHNAWLGGSILASLSTFRRL
LITSEEYKNDQNVIFRRRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgactgttactgaaatctttgataatcagccgatatgtatcgacaatggctctggattt
attaaagctggattcgctggcgatgatattcccaaatgcctttttccgacttgtgttgga
agaattaagcatgagcgtgtcatgccaagtagtatccaaaaagatatgtttgttggttct
gaggctcaaaatcttcgcgggttgcttaaaattcaacgtccaattgaacggggaatcatc
caaaattggtccgatatggaagagatttggagctatatttattcagatcaacagctcaat
actttaccggaagaacatcccttgcttttaaccgaacctcctttggctaacatccgaaac
aaagaaaaaattgcagagtatttttatgaaacgttaaacgttccagcattgagcttttcc
ttgcagcctgtattggcactgtatgcctccgcacgtacaactggcattgttcttgaatgt
ggagatggcttgactcatagtgttcctatttatgatgggttttccattccatcagctata
caacaagaggaaattggaggtcgtgacgttacagattatttgcaattgcaacttcgaaaa
tctggccacgaactcgtcagctcggcggagaaagaaattgtccgggaaattaaagaaaaa
tgttgctacgtagcatctgactttagatcagaaatagaatcatggactgaacacaaaccg
cagattcatacatatcaactcccagacaaccaaactataactttgggtacagaatgcttt
tctgcgcctgaggttttattcaacccggaaatgatgggttctgaggcgtctggtcttcac
atacaattgttcaagtctattttattgtccgacatcgatttaaggtcaaccttatattca
aacattgtactttctggaggttcaacgttattgagaggatttggggagagattcatctct
gagttacgtgcaatttctgggaaaaaaaatcaagttaaaatttatgcttcccctgaacgt
atgcataatgcttggcttggcggctcaatattagccagtctaagtacatttcgtcggctt
ttaattacttcagaggagtataaaaatgatcaaaacgtaatttttaggcgaagattttga

DBGET integrated database retrieval system