KEGG   Schizosaccharomyces pombe (fission yeast): SPBC13G1.04c
Entry
SPBC13G1.04c      CDS       T00076                                 

Definition
(RefSeq) alpha-ketoglutarate-dependent dioxygenase
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: 2OG-FeII_Oxy_2
Other DBs
NCBI-GeneID: 2539935
NCBI-ProteinID: NP_596553
PomBase: SPBC13G1.04c
UniProt: O60066
Position
II:complement(join(3732806..3732930,3732994..3733777))
AA seq 302 aa
MLAGNMEQANVFRLEEKRYKCRADTIPDMSEVLDPNDPQSFGFEALVEIKPRVFSFQKAP
GLLILKNYVSSELQMQLLKSIMFTQIQDPENKTNLSPFYQLPLGNDSIWRRYYNGDGESI
IDGLGETKPLTVDRLVHKKLRWVTLGEQYDWTTKEYPDPSKSPGFPKDLGDFVEKVVKES
TDFLHWKAEAAIVNFYSPGDTLSAHIDESEEDLTLPLISLSMGLDCIYLIGTESRSEKPS
ALRLHSGDVVIMTGTSRKAFHAVPKIIPNSTPNYLLTGNKAWDGWISRKRVNFNVRQVRP
SR
NT seq 909 nt   +upstreamnt  +downstreamnt
atgctagcgggaaacatggaacaggcgaatgtttttcgtttagaagaaaaacgctataaa
tgtcgtgccgacacaattcctgacatgtctgaggtccttgatcctaatgatccccagtct
tttggatttgaagctttagttgaaattaaacctagagttttttcttttcaaaaagctcct
ggattattaattcttaaaaactatgtttcatcggaactgcaaatgcagctgttaaaatct
ataatgtttacgcaaattcaagatcctgaaaacaagaccaacctttcaccattttatcaa
ctaccattaggtaatgatagcatatggcgcagatattacaatggtgatggagaaagtatc
attgacggccttggagaaactaagcctttgacggttgacagactagttcataaaaagctt
cgatgggttacactaggtgaacagtatgactggacgacgaaggagtatcctgatccttcc
aaatctcctgggtttcccaaagatttaggtgactttgttgaaaaggttgttaaagagagc
acagattttttacattggaaagctgaagctgcaatcgtaaatttttattctcctggtgac
acattgagtgcacatatcgatgaatctgaagaggatttgacacttccattaatttctctc
tcaatgggtttggattgcatatatttgatcggtaccgagtcgaggtcggaaaagccttca
gctttacgtttacacagtggagacgttgtaattatgactggaacttctagaaaggctttc
catgctgttcctaagattatacccaactctacgcctaattacctattgactggaaacaag
gcttgggatggatggatttcaagaaagcgagtgaacttcaatgttagacaggttaggcct
tctagataa

DBGET integrated database retrieval system