KEGG   Schizosaccharomyces pombe (fission yeast): SPBC13G1.08cHelp
Entry
SPBC13G1.08c      CDS       T00076                                 

Gene name
ash2
Definition
(RefSeq) Ash2-trithorax family protein
  KO
K14967  COMPASS component BRE2
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPBC13G1.08c (ash2)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic Type
  Histone modification proteins
   HMT complexes
    COMPASS/SET1 complex (yeast)
     SPBC13G1.08c (ash2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SPRY PHD
Motif
Other DBs
NCBI-GeneID: 2539667
NCBI-ProteinID: NP_596557
PomBase: SPBC13G1.08c
UniProt: O60070
Position
II:complement(3738975..3740933)
Genome map
AA seq 652 aa AA seqDB search
MLAHGSNDYGVSLKGNKTGSSPSKASSLNWNEPHTLNEQNTYCYCGKDRNLRFPDLQCSV
CLNMFHLSCLSPPCTSMMGFSTNYQFVCKHCTEDGFERFERGVSAWKAITATAMANLVVK
RYVETNPDVPVDSFNAEKMRNFQANTYFFKKKEDLIPFIEEHWQLLCPDREKVQTWQATL
GSCLVANRDTYRAKDETMRNQNSEYALNNPNLFDFRSGYIFPFQRVGATVPKKRLVETET
PPPSSSKLKEDYKDSKREMKRSNTPWSNASIKKNEVPTVPIRYKPPPWRDSDFETVPKLP
IFYPNSSSPNFFSLSEIPFNRRGFRYSPCEAAKDLPNVMYREIELPPFTSRINWHDISTP
VFIDHSALCATVEKGFRMARSNVFMTSGEWYFEIKIEKGGGDDGAHVRIGVSRREAPLDA
PVGYDAYSYGLRDLGGQKVHMSRPRNFMDSFGTGDIIGLHISLPKPSFAQHTTLPSCHDR
IPIRYKGQLYFEQPDYVPSKMMDELMIPSKHNRYIDLPYIPGSFIKVYKNGSYMGTAFEN
LLDFNPPNSINSNHYSFDDGSLGYYPSISMYGGGIARFQFGPQFSHRPLVLGSNVRPVSE
RYNEQIAEDVLCDILDEIDYAEDPNTSSVTIDVPQEPNAGITIIPEIKDITE
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgctggctcatggatccaatgattatggagtttccttaaaggggaataaaaccggttcc
tctcctagtaaagcatcttctctaaattggaatgaacctcataccttgaacgaacagaac
acctattgctattgtggaaaagatagaaatttaagattccctgatcttcagtgtagcgtt
tgtttaaatatgtttcatctctcgtgtttaagtcctccttgtacgtcgatgatgggattt
agtacaaattatcaatttgtctgtaagcattgcactgaagacggatttgaacgatttgaa
cgaggtgtatccgcatggaaggctatcactgctactgcaatggccaatcttgttgttaaa
cggtatgttgagaccaacccagacgttcctgtcgatagttttaatgccgagaaaatgaga
aattttcaagcaaatacatatttttttaagaaaaaagaagatttaattccattcatcgaa
gaacactggcagctattgtgtcccgatcgtgaaaaagtacaaacttggcaagctactttg
ggtagttgccttgtggctaacagagacacataccgagctaaagatgaaacgatgagaaat
caaaactctgaatatgctttaaacaacccgaacctttttgactttcgttcaggttatata
tttccatttcaacgagtgggagcaactgtaccaaaaaaacgtttagttgaaactgaaact
cctcctccttcatctagtaagcttaaggaagattacaaggattccaaaagggagatgaag
agatctaatactccttggtcgaatgcgtctataaaaaaaaatgaagttcccaccgtaccc
atacgctacaaaccgcctccttggagagattctgattttgaaactgttcctaaattacca
atattttatccaaattcctcatcccctaattttttctctctctctgaaattccctttaat
cgaagaggattccgctatagtccttgtgaagcagccaaagatttaccaaatgtcatgtac
agagagattgaacttccaccgtttacgtctcggattaattggcatgatatttctacacct
gtctttattgatcactctgctctgtgtgcaactgtggaaaagggatttcggatggcaagg
tccaatgtttttatgacctccggtgaatggtattttgagataaaaatagagaaaggagga
ggtgatgatggagcacatgtcagaattggagtttctagacgtgaagcccctttggatgct
cctgttggctatgatgcttattcgtatggacttagagacttgggtggtcaaaaagttcat
atgtcacgtccacgaaactttatggattcttttggtacaggagacataattggattacat
atatctcttcctaaaccgtcctttgcccaacatactactcttccctcgtgtcatgataga
atccctatcagatataaaggacaactatattttgagcaaccagattatgtaccaagcaaa
atgatggatgagctaatgattccatctaaacacaatcgttatatagacttaccttacatt
cctggatcatttataaaagtttacaaaaatggctcatatatgggtacagcctttgaaaat
ttgcttgattttaatccccctaattcaatcaattcaaatcattattcatttgatgacggt
tctcttggttattatccttctattagtatgtatggaggtggaatagctcgcttccaattt
ggtcctcaattttctcaccgtccgcttgtcttaggttcaaatgtcaggcctgtttcagaa
agatataatgagcaaattgcggaagacgtcctttgcgacatccttgacgaaatagattat
gcagaagacccaaatacgtcttctgtgactattgatgttcctcaggaaccaaatgcaggc
ataacaataattccggaaattaaggatataaccgaatag

DBGET integrated database retrieval system