KEGG   Schizosaccharomyces pombe (fission yeast): SPBC13G1.10c
Entry
SPBC13G1.10c      CDS       T00076                                 

Gene name
mug81
Definition
(RefSeq) putative ATP-dependent RNA helicase Slh1
  KO
K18664  antiviral helicase SLH1 [EC:3.6.4.13]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:spo03019]
    SPBC13G1.10c (mug81)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     SPBC13G1.10c (mug81)
Messenger RNA biogenesis [BR:spo03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     SPBC13G1.10c (mug81)
SSDB
Motif
Pfam: Sec63 DEAD ResIII Helicase_C AAA_22 AAA_19 AAA PhoH Helicase_PWI
Other DBs
NCBI-GeneID: 2539673
NCBI-ProteinID: NP_596560
PomBase: SPBC13G1.10c
UniProt: O60072
Position
II:complement(3744068..3749875)
AA seq 1935 aa
MEVELNYVVNHLEKLGPASFCDTPYSFSLSDSNAELGALSLKVDEILKTNYNLINPEDVT
DSDNNEFALKDLTWLQNCCNEISQSSSTELDASVLFEAVIMSLKATEDQCAIQEDLLNLV
GLDHIDLISDIVANSSNLIEEYMNQNDTSIAAQLSDGYTSEAGSSATHGQGLLDSLKSRP
RRFSRSRDNRGPLFTGQQVFEVEKYPHVYGDKRLGNTISVIGKKFALPAGSEREDYQKYE
EIIVPHAQRAPQMQGEKLLEISSMDILCRKTFLSYQTLNRIQSLVYPIAYKTNENMLICA
PTGAGKTDVALLAMLQTISNYVESMNLMDESEPLDVHRDDFKIVYIAPMKALAAEVVEKM
GKRLAWLGLKTRELTGDMQLTKTEIAETQILVTTPEKWDVVTRKSVGDTQLAEKVRLVII
DEVHMLHDERGAVIESLVARTQRLVETSQQMIRIVGLSATLPNYLDVADFLGVNRYKGLF
YFSSAFRPCPIEQHFIGAKGSPKIVNSNIDEACFDKVLKLIQEGHQVMIFVHSRKETINS
AKKLREQFFHEGEADLLDNSQHEKYSLAQRDVSKSKNKELKELFKYSMGIHNAGMLRSDR
HLTERLFSMGILKILCCTATLAWGVNLPAYAVLIKGTQLYDPQKGSFVDLGVLDVLQIFG
RAGRPQFESSAVAYIITTHDKLSHYISVVTQQSPIESRFTDRLVDNLNAEVSLGTVTNID
EAVSWLGYTYLYIRMRRNPLVYGIAYDELVEDPLLGSKRRELVSVAAGRLADNQMIVYNK
KNGYLIPKDLGRIASNYYINYQTVSTLNNLLKSKMSEADIIALLSQCSEFSQIKSRENEH
RELESLMENSSPCQLRDSISNTSGKVNVILQSYISRAHVEDFTLTSDTNYVAQNAGRITR
ALFEIAMSRTWASAFTILSLNKSIDRRQWSFEHPLLQFDLPHDLAVKVENQCGSLSLEEL
SDMSTGELGDLIHNRKMGPTVKKFISKLPLLNINVDLLPLTKNVLRLVLNITPNFNWDMR
YHGNSQMFWIFVEDSNGLEILHHEQLLLNKRNVSTSHLLSFTIPVSNPLPSQLYIIAVSD
KWLGAETVTPVSLSNVVFHDDSNPITELLDLQPLPITALHDPVLEGICAKRFSFFNAVQT
QFFHTIYHTDTNIFVGAPTGSGKTMAAELATWRALHNYPKSKVVYIAPMKALVKERVKDW
GHRLVEPMGISMIELTGDTNPDVKAVTNANIIITTPEKWDGITRSWKSRKYVQDVSLIIL
DEIHLLGSDRGPVLEMIVSRMNYVASQTNKKVRVLGLSTAVANANDLANWLNIRDGLFNF
RHSVRPVPLEIYIDGFPGRAYCPRMMSMNKPAFQAIKTHSPTQPVLIFVSSRRQTRLTAK
DLIAFCGLEDNPRRFLYMDEEELEMIVSEVEDKSLKLALPFGIALHHAGLTENDRKISEE
LFVNNKVQILIATSTLAWGVNTPAHLVIVKGTEYYDAKIGGYKDMDLTDVLQMLGRAGRP
QFDNSGVARIFVQDIKKSFYKHFLHSGFPVESYLHKVLDNHLNAEIATGTIDCIQGAMDF
LTCTYFYRRVHQNPVYYGADGDDQKSIDTYLSKLVVTAFNELEKSACIYRVNEETYAPTT
LGRIVSYYYLFHTTIRNFVQKITENAEFDLALQLLAEASEFDDLAIRHNEDLINIEINKS
LKYSAACLNLPMVDAHVKAFILTQAHMARLKLPVDDYVTDTSTVLDQVIRIIQSYIDVSA
ELGYSHVCLQYISLMQCLKQACYPSEIYRASLPGLNASSEKEARDYLNKFAGNKTDELYQ
MLCNDPNVFDIESLVNSLISYPKMNIEVSQSSSDKLLLYLRRLNQPLNPDFYIFAPLFPK
PQSEGFFVLIIDSETQELFAIRRASFAGRRNDDSIRLSLRISMDIPPTCRNRNVKVMVVC
DGYPLIYEHKIVLMI
NT seq 5808 nt   +upstreamnt  +downstreamnt
atggaagttgagttaaattatgtagtgaatcacttagaaaagctaggtcctgctagtttt
tgtgatactccatatagcttttcgctgagtgattcgaatgctgagctaggtgctttatcg
ttaaaagttgacgaaattttgaaaacaaattataatttaatcaatcccgaggacgttact
gactccgacaataatgaatttgctcttaaagatttaacttggctgcaaaattgctgcaat
gaaatttctcaatcttcaagtactgaacttgatgcttcagtactatttgaagcagtcatt
atgagcctaaaagcgactgaagatcaatgtgccattcaagaagatttactgaatcttgtt
ggacttgatcatattgacttgatttcagatatcgtcgctaattcgtccaatttaatagaa
gaatacatgaatcaaaatgatacttcaattgctgcgcaactttctgatggctatacctct
gaagctggttcttctgctacgcatggtcagggattattagacagtttaaaaagtaggccg
agaagatttagtcggtctcgtgataacagaggtcctttatttactggacagcaagttttt
gaagtggaaaaatatcctcatgtgtatggggataaaaggcttggtaatactattagcgtc
attgggaaaaagtttgcattaccggctggtagtgaaagagaagattaccagaaatatgaa
gagattattgttcctcatgctcagcgtgctccacaaatgcaaggggaaaagttgttagaa
atttcttcgatggatattctttgtcgaaaaacattccttagctaccaaactttgaacaga
atccaatcgcttgtctatcctatcgcctacaagacaaacgagaatatgttaatttgtgca
cctacaggtgcaggaaaaactgatgttgctctgctcgcaatgttgcaaacaatctccaac
tatgtagaaagtatgaatcttatggatgaatcggaacctctagatgttcatagagatgat
tttaagattgtctacattgctcctatgaaggcattggctgctgaggttgtagagaaaatg
ggaaaacgtctcgcttggttgggattgaaaactagagaacttactggtgatatgcaacta
accaaaacggaaatagcagaaactcagatacttgttacaacacctgaaaaatgggacgta
gttactagaaaaagcgtcggcgacactcagttagccgagaaagtacgtttggttatcatt
gatgaagtacatatgcttcatgatgaacgtggtgctgttattgaatcacttgtcgctagg
acacaaaggctggtagaaacaagtcaacagatgattagaattgttggtctttctgccaca
cttccaaactaccttgatgtagctgattttttaggcgtcaataggtacaagggattgttt
tatttttcatctgcatttcgtccatgccctattgaacagcatttcatcggtgctaaaggt
tctcctaaaatagtaaactcaaatattgatgaagcttgttttgataaagttttgaaactg
attcaggaaggccatcaggtaatgatatttgtacattctaggaaggaaaccattaattca
gctaagaagttgagggaacaatttttccatgagggagaggctgatttgttggacaactca
caacatgaaaaatatagtctagctcaaagagatgtttcaaagtcaaaaaacaaagagtta
aaagaacttttcaaatacagtatggggattcacaacgctggcatgttacgatcggaccga
catcttactgaacgtttgttttctatgggtattcttaaaattttatgctgtactgctacc
ctagcatggggtgttaatttaccggcttatgctgtattaattaaaggaactcagctttat
gatccacaaaagggttcttttgtagatcttggcgtgttggacgttttacaaatattcggt
cgtgctggtcgtcctcagtttgaaagttcggcagtcgcgtacataattacgacacatgat
aaactttctcattacatctccgttgtaacacaacaaagccctattgaatctcgtttcacc
gatagattggttgacaacttaaacgctgaagtttctttaggaacggtaactaatattgac
gaagctgtatcgtggttaggttatacttatctttatatcaggatgagacgtaatccactt
gtatacggtattgcttatgacgaacttgttgaggatcctttactaggcagcaagcgaaga
gaattggtatctgtagcggcaggaaggctggcagataatcaaatgatcgtttacaataag
aaaaacggatacctgattcctaaagatttaggtagaatcgcgtccaattactatatcaat
tatcaaactgtctcaacattaaataatttattgaaaagcaaaatgtcggaagcagacatt
atagctcttttgagccaatgcagcgagttttcccaaatcaaatcgagagaaaatgagcat
cgtgagcttgaatcactaatggaaaacagtagtccttgtcagttgagggatagtatttcg
aatacatcaggaaaagttaacgttattctgcagtcatacatttctcgtgcgcatgtagaa
gattttaccctaacatcagatacaaattatgttgcacaaaacgcgggtcgaataactagg
gctcttttcgaaattgcaatgtcaaggacttgggcctcggcatttactatccttagctta
aacaagtcaattgataggaggcagtggtcttttgaacaccccttacttcagtttgatctt
ccacatgaccttgcagtcaaagtggaaaatcagtgtgggtctttatcattagaagaattg
tcggacatgtctacaggagaacttggtgatcttattcataaccgaaaaatgggccctaca
gttaaaaaatttatttccaaattacctcttttaaacattaatgttgatttgctaccttta
acgaaaaacgttttgcgacttgtattaaatatcactcccaattttaattgggacatgaga
tatcatggaaacagtcaaatgttttggatatttgttgaagatagtaacggtcttgagatt
cttcatcatgaacagttgctcctaaataaacggaacgttagcacttctcatttactatcc
tttaccatacctgtgtctaatccattaccctcacaactatacattattgcagtatcagat
aaatggctaggcgctgaaacagttaccccggtttctctttctaatgttgtttttcatgac
gattccaatcccattacagaattattggatcttcaacctttaccaattacggctttgcac
gatccagtgctagaaggtatatgcgctaaaagattctcgttttttaatgcagtccaaact
caattttttcacactatttatcacaccgatacaaatattttcgttggtgcacctactgga
tctggtaaaactatggccgcagaattagctacttggagagctcttcacaattatcctaag
tcgaaagtagtttatattgctccaatgaaagctttagtcaaggaaagagtaaaggactgg
ggacacaggttagttgaaccaatggggattagtatgattgaattaactggtgatactaac
ccggatgttaaggctgttacgaatgcaaatatcataattacaacaccggaaaaatgggat
ggtattactagaagttggaaatctaggaagtatgttcaggatgtctcattaattatcctt
gacgaaatccatttattaggtagcgatcgaggtcctgtccttgaaatgattgtctcccga
atgaattatgttgcttctcaaactaataagaaagttagagttcttggtttatctactgct
gttgctaacgctaacgatcttgcaaattggcttaacataagagatggtctatttaatttt
aggcattccgtgcgcccagttcctttagaaatatatatcgatggattccctggtagagcc
tattgcccaaggatgatgtcgatgaataagcctgcttttcaagccatcaaaacgcactct
cctacccaacctgttttaatttttgtttcgtcgcgccgtcaaactagattaactgcaaaa
gatttgatagctttttgtggtttagaagacaatcctaggagatttttgtacatggatgaa
gaagaattagaaatgattgtttcagaagttgaagataaaagcctcaagttggctttacca
tttggtatagcacttcaccatgctggtttgactgaaaatgatagaaaaatttccgaagag
ctttttgtaaataataaagttcagattctcatcgccaccagcactcttgcatggggtgta
aatacgccggcacatttggtaattgtgaaaggaacagagtattacgatgctaaaattgga
ggctataaagacatggatttgacggatgtgcttcaaatgttagggcgtgcaggacgacca
caatttgacaattctggtgtggcacgtatatttgtacaggatattaagaagtcgttttat
aagcactttctacatagtggatttccagtagagtcttatttacataaagtattggataac
catttaaatgccgagattgctacgggcactatagattgcatacagggtgcaatggatttt
ttaacgtgcacttacttctatcgaagagttcatcaaaatcccgtttattacggtgctgat
ggagatgaccaaaagagtatagatacttatttatcgaaacttgttgtgactgcatttaat
gaacttgaaaagtcagcttgcatatatcgtgtcaacgaagaaacctatgcacctacaact
ttgggtcgtatagttagttactattatctttttcataccaccatcagaaacttcgttcaa
aaaataactgagaacgctgagttcgatcttgcgttgcaattgcttgctgaagcatctgag
tttgacgatctcgctattcgtcacaacgaagatttgataaacatagagattaataaatct
ctgaaatattcggctgcttgcctaaaccttcctatggtcgatgctcatgttaaggcattt
atattaactcaagctcacatggcaagattgaaacttccagtggatgattatgttactgat
actagcacggttttagatcaggttattcgtattatacagtcttatattgatgtgtccgct
gagctaggctactcccatgtctgtttacagtacatatctctaatgcagtgtcttaaacag
gcttgctatccgagtgagatttacagagcttcattacctggacttaatgcgtctagtgaa
aaggaagcaagagattatctcaacaaatttgcaggaaataaaactgatgagttatatcaa
atgctatgtaatgaccctaacgtttttgatatagaaagtctggtcaatagtttaatttcg
tatcctaaaatgaacattgaagtttctcaatcgtcttcagataagctactcctttatcta
cgacgcctcaatcagccgctcaaccccgatttttacatttttgcgccgttgttccctaaa
cctcaaagtgagggatttttcgttctcatcatagattcagaaactcaagaactgttcgcg
atacgtcgggcctcatttgctgggcgaagaaacgatgattcaattcgtttatcccttcgg
atttcaatggatattccaccaacttgccgcaacagaaatgtaaaagtcatggttgtttgt
gatggatacccattaatttacgaacataaaattgtattgatgatttaa

DBGET integrated database retrieval system