KEGG   Schizosaccharomyces pombe (fission yeast): SPBC13G1.13
Entry
SPBC13G1.13       CDS       T00076                                 
Symbol
tfb2
Name
(RefSeq) transcription factor TFIIH complex subunit Tfb2
  KO
K03144  transcription initiation factor TFIIH subunit 4
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03022  Basal transcription factors
spo03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    SPBC13G1.13 (tfb2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    SPBC13G1.13 (tfb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:spo03021]
    SPBC13G1.13 (tfb2)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPBC13G1.13 (tfb2)
Transcription machinery [BR:spo03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     SPBC13G1.13 (tfb2)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     SPBC13G1.13 (tfb2)
SSDB
Motif
Pfam: Tfb2 Tfb2_C Helicase_C_3
Other DBs
NCBI-GeneID: 2539790
NCBI-ProteinID: NP_596563
PomBase: SPBC13G1.13
Ensembl: SPBC13G1.13
UniProt: P87303
Position
II:3753813..3755717
AA seq 447 aa
MQAEFKSSINDFLEQLPNHARLYQKPAACLAVFRLLPILARQYVMSMLFNPMPVALSDFD
LWIKLSSKVYQSESFNKLVRMHIFQFDGQYITLNSEFRKQFITALTGGGNHNSFGVPCTD
EDKHLVTVDFLDAYAKETWETILHFMVGTPEAKFPGEGVLSLLKRGGLMSGPKNQLRITR
AGFQFLLQDINAQIWTLLLDYLKLSEDTHMDPVQVLHFLFMLGSLDLGRAYSVDFLTDTQ
QIMLEDLREYGLVYQRKITSKRFYPTRLATGLTTDYRSLHGKQSENDDDKGFIIVETNYR
LYAYTSSPLQIAIIGLFANLRARFSNLVVGVITRDSIRRALMNGIAAEQIITYLTTHAHP
QMRSNVPLLPPTLVDQIYLWELEKNRLRATPGILFRDFLTDSGFDQAVEYAKELGVLVWD
SSLKRMFFITTTGAQPMIAYLKRRAVK
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgcaagcagaattcaagtctagtatcaacgacttcctggaacagttaccaaatcatgca
aggctttaccaaaagccagctgcttgtcttgctgtgtttcgtttattgccaattctagct
agacagtatgtcatgtctatgcttttcaatcctatgccagtagcactctcagatttcgat
ttatggatcaaactttcgagtaaagtttatcaatctgaatccttcaacaaactggttagg
atgcatatatttcaatttgatggacaatatatcactctaaatagtgaatttcgcaaacaa
tttataactgctctgactggaggaggaaatcacaattcgtttggcgtgccatgtaccgat
gaagacaagcacttggtgacggttgattttcttgacgcatatgcgaaagaaacttgggaa
acaatcttgcacttcatggtaggaactccggaagctaaatttcctggagaaggtgtctta
agtctattaaagcggggcggtttaatgtctggtccaaaaaaccagctacgtattacccgt
gccggttttcagtttctgttacaggatataaatgctcaaatttggacgttacttttggat
tatttaaaactatctgaagacacgcatatggatcctgttcaggttttgcactttttattt
atgcttggaagtttggatttggggagggcatactcagtggacttcttaacagatacacaa
caaatcatgcttgaagacctaagagaatatggattagtttatcaaagaaaaattacttcc
aagcgtttctatccaaccagactggcaacaggtctgacaactgattatcgctcattgcat
ggaaagcaaagtgaaaatgatgatgataaaggttttattattgtagaaacaaattaccga
ttatatgcttacacaagctccccattacagattgccatcatcggattgtttgctaactta
agggcgcgtttttcaaatcttgttgtcggtgtgataactcgggatagtattcgtcgtgct
ttgatgaatggaattgcagcggagcaaattattacatacttgacaactcatgctcaccct
cagatgagatcgaatgttcctcttttacctcctacattagtagatcaaatttatttatgg
gaattggaaaaaaatagacttcgggctactcctggaattttgtttcgcgattttcttact
gattctggcttcgaccaagcagtagagtacgcaaaagaactcggggttttggtttgggac
agttccttgaaaagaatgtttttcataactacgacaggcgcccagcccatgatcgcatac
ttgaaaagacgagctgtcaaatga

DBGET integrated database retrieval system