KEGG   Schizosaccharomyces pombe (fission yeast): SPBC146.14c
Entry
SPBC146.14c       CDS       T00076                                 

Gene name
sec26
Definition
(RefSeq) putative coatomer beta subunit protein
  KO
K17301  coatomer subunit beta
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPBC146.14c (sec26)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPBC146.14c (sec26)
Membrane trafficking [BR:spo04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    SPBC146.14c (sec26)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SPBC146.14c (sec26)
SSDB
Motif
Pfam: Adaptin_N Coatamer_beta_C Coatomer_b_Cpla Cnd1 HEAT_2 HEAT Coatomer_g_Cpla
Other DBs
NCBI-GeneID: 2539798
NCBI-ProteinID: NP_595403
PomBase: SPBC146.14c
UniProt: Q9UUF7
Position
II:complement(1029116..1031938)
AA seq 940 aa
MSCWTLVQQDFLEAPSVDALKTSLESKNDYVKISAMKTILRVVINGDSLPSILMHVIRFV
MPSRNKELKKLLYYYWEVCPKYNNDGTMKQEMILACNSFRNDLQHPNEFIRGATLRFLCK
LKEPELLDPLIPTVRQCLEHRHAYVRKNAILAVFSIYQVSNHLIPDAASLAEDFLAAESE
GTCKRNALIVLFTIDPEKAKAWLLANFEQIPSLNASSLLVIIEFIRKVVLTKADGLEKLR
FQSLLVSLTATNNSSVVFEAATSVINVFPDAESLKLAASRLLALADREADNNAKLIMLDR
ISQLAARDKSILEDLITDVIPFLSSSDFDVCEKAISIIMGLVSSRNVEDILNHFQKELTK
SNGETEKDDGRRRALTKAIHSCAINFPHTAATAIQYLLSHISDFQSKSASSVLSFIKEVM
EKFPDLRSSNITKLLLSLKELRAGKIFRGVIWIAGEYCLTEDDIRVAWKSIRASLGEVPI
LASEEQLLKDVSNVPEDDLLIDISAPASTSRKVLPDGTYATESAVTSEALSAARLEAVKA
SKKPPLRTQILSGDYYLAAVLASALTKLVMRFARLSFDKERLNALKAEACLIMTSIIRVG
QSKFVKYTIDDDSVERIMNCIRAIYSFEELPEFQTVFLDDMRKAFSSLVAQSDKRQKEAD
LLVNGSDAVQADELLNIRQFQRVIEEKQDLNFESDIIQATNDGMVVEDLASKLDHIVQLA
GFTDPVYCEAYVKIQQFDIILDILLVNRTDTTLQNLSVDLATLGDLKVVERPPPMNLGPH
AFKSVQATVKVSSTESAVIFGNIVYGGKASDEDKIVVLNGIPVNIIDYIKPAFIPESQFR
SMWTEFEWENKVDISSNEDISLYDFLHKIMKKTNMNCLTPDASLRGDCGFLSANLYACSI
FGEDALMSLSVEKSVSGPISGHVRIRSKTQGIALSLGAFV
NT seq 2823 nt   +upstreamnt  +downstreamnt
atgtcttgttggacacttgttcaacaggattttttagaagctccatctgttgatgctcta
aaaacctcgttagagtccaaaaatgattatgtcaagatatctgccatgaagacaatcctg
cgggtcgtaattaacggggattctcttccttccattttaatgcacgtgattcgatttgta
atgccttccagaaataaagaactgaaaaagcttttgtactattactgggaagtttgtcct
aagtataacaacgatggcactatgaaacaagaaatgatcttagcttgtaactcatttcgc
aatgacttgcaacatcctaatgagttcattcggggagctactttacgatttctttgtaaa
ttgaaagagccagagcttttggatcccttaatcccaaccgtccgccaatgcttagaacat
cgtcatgcctatgtccgtaaaaatgctattcttgccgtctttagcatatatcaagtctct
aatcatctcattcctgacgctgccagtttagccgaggacttccttgcagctgagtctgag
ggaacttgcaaacgaaatgctttaatagttttgtttactatcgatcccgaaaaagctaaa
gcttggcttttggcaaattttgagcaaattccctctctgaacgcttcttcccttctcgtt
atcattgaatttattcgtaaagtcgttttaacgaaagctgatggtctcgaaaaacttaga
ttccaatctcttttggtatccttgactgccacaaacaatagtagtgtagttttcgaggca
gctacttcagttattaatgtatttcccgatgcggagtctctgaagctcgctgcgtctcgt
ctattagcactagcagatcgcgaagccgacaataacgccaagttaattatgctggatcgt
atttctcaattggcggcccgtgataaatcaatcttagaagacctcataacagatgtgatt
ccattcctttctagttcagattttgatgtctgtgagaaagctatctcaatcattatgggc
ttagtttctagcagaaacgttgaagacatacttaaccattttcaaaaggaacttactaaa
tcgaatggagaaactgaaaaggatgatggtcgccgtcgtgctcttacgaaggctattcat
tcttgtgctattaacttccctcacactgctgctactgctatccaatacttactcagccat
atatcggactttcaaagcaaatccgcttctagtgttttatcatttattaaagaggtcatg
gaaaaattcccggatctccgatcatcaaatattactaagctcctgctctctttgaaagag
cttcgtgctggtaaaattttccgtggtgtaatatggattgctggcgagtactgtctaact
gaggacgatatacgcgttgcgtggaagagtattagagcaagccttggagaagttccaatt
ttggcgtcagaggagcaacttttaaaagacgtttccaatgtacctgaggacgatttgctt
attgatatatctgctccggcttcaacaagtcgaaaggtccttcctgatggaacctacgct
accgagagtgcagtcactagtgaagctttaagtgctgctcgtttggaggctgtcaaagct
tcaaaaaagccaccgttgcgcacacagattttgagtggtgattactatcttgctgctgtt
ttagcttctgctcttacaaagcttgtgatgcgttttgctcgactttctttcgacaaagaa
cgattgaacgctctcaaagctgaagcatgtcttattatgacatctataattcgagtgggt
cagtccaagtttgtaaaatataccattgatgatgactctgttgagcgtattatgaactgt
atcagggccatatattcctttgaagagcttcctgaattccaaacggtgtttcttgatgat
atgcgaaaagcattttcatcacttgttgctcaatcagacaagcgacaaaaggaggcagat
ttgttagttaatggaagtgatgctgttcaagccgatgagctactgaatattcgccaattt
caaagggtcattgaagaaaagcaggatcttaattttgagtccgacatcatacaagccacc
aacgatggtatggtagtggaagatttggcatctaaattagatcatatcgtacaattagcc
ggttttacagatcctgtttactgtgaggcatatgtgaagatacaacaatttgatattatt
ctagacatattattggttaatcgaacggataccacgttacagaatctctctgttgatttg
gctacgttgggagatcttaaggttgtagagcgtccaccacccatgaatttaggacctcat
gcctttaaatctgttcaggctacggtaaaggtatcttcaacggagtctgcagtaatcttt
ggaaatatcgtgtatggtggtaaagcatccgacgaagacaaaattgttgttttgaatggc
attccagtcaacattattgattatataaaacccgcattcattcccgaatctcaattccgt
agcatgtggacggaatttgaatgggaaaacaaggtcgatatttcttccaacgaagacatt
agtctgtacgatttcttacataaaataatgaagaaaaccaatatgaactgtcttactcca
gacgcgtctctgcgtggtgactgtggttttttgagtgctaatttgtacgcctgcagtatt
tttggggaagacgcacttatgagtcttagcgttgaaaaatccgtctccggtcctatctca
ggacatgttcgcattcgttcaaaaactcaaggcattgcccttagcttgggtgcatttgtt
tag

DBGET integrated database retrieval system