KEGG   Schizosaccharomyces pombe (fission yeast): SPBC14C8.03
Entry
SPBC14C8.03       CDS       T00076                                 

Gene name
fma2
Definition
(RefSeq) putative methionine aminopeptidase Fma2
  KO
K01265  methionyl aminopeptidase [EC:3.4.11.18]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:spo01002]
    SPBC14C8.03 (fma2)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.18  methionyl aminopeptidase
     SPBC14C8.03 (fma2)
Peptidases and inhibitors [BR:spo01002]
 Metallo peptidases
  Family M24
   SPBC14C8.03 (fma2)
SSDB
Motif
Pfam: Peptidase_M24 DUF3391
Other DBs
NCBI-GeneID: 2539692
NCBI-ProteinID: NP_595906
PomBase: SPBC14C8.03
UniProt: O60085
Position
II:2207732..2209012
AA seq 426 aa
MTSATTTEATAKDLQEKLSLKENDVVEDDGKVEENDAAEEGASNGEKKKKKKKKSSKKKK
TPQEQTNPPTVGLSKIFVNKKYPVGEVCDYAEDNLWRTTDEEKRALDRQNFDQYNDLRRA
AEVHRQARQYAQSVIKPGMSMMDVVNTIENTTRALVEEDGLKSGIGFPTGVSLNHCAAHY
TPNAGDTTILKEKDVMKVDIGVHVNGRIVDSAFTMSFDPQYDNLLAAVKAATNKGIEEAG
IDARLNEIGEAIQEVMESYEVEINGKTHQVKSIRNLCGHNLDPYIIHGGKSVPIVKGGEE
IKMEEGEIFAIETFGSTGRGVVHEDMECSHYAKIPDAGHIPLRLPRAKALLNTITQNFGT
LPFCRRYLDRIGESKYLLALNNLVSAGIVQDYPPLCDIRGSYTAQFEHTIILHPTQKEVV
SRGDDY
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgacttctgcgacaactactgaagctaccgctaaagatttacaggagaagctttcgctg
aaagagaacgacgtggttgaagatgatggaaaagtagaggaaaatgatgccgctgaagaa
ggagccagcaatggagaaaagaagaaaaaaaagaaaaaaaagtcttctaaaaagaaaaag
acccctcaagaacaaaccaatcctccaactgtcggattgtccaagatctttgtcaataag
aaatatcccgttggtgaagtttgtgattatgctgaagacaatctgtggcgtacaactgac
gaagagaagcgcgctttggaccgacaaaattttgatcagtataatgatttgcgtcgtgct
gctgaagtacatcgccaagctcgtcagtacgctcaatccgttattaagcccggcatgtct
atgatggacgttgtcaacacgatagaaaacactacacgggctttggtcgaagaggatgga
ttgaaatcaggtattggtttccccacaggtgttagtttaaatcattgtgccgcccattat
actcccaacgctggtgataccaccatacttaaggaaaaagatgttatgaaagtcgatatt
ggtgttcatgtgaacggcaggattgttgattctgcttttaccatgtctttcgatccccag
tacgacaaccttttggccgcagtcaaggctgctactaataagggtattgaagaagccgga
attgatgcacgcttgaacgagattggtgaagccattcaggaagtcatggaaagttatgaa
gtggaaattaacggaaaaacacatcaagtaaagtctatccgtaatttgtgcggtcacaat
ttggatccttatatcattcatggtggtaagagtgttcccatcgtcaagggcggtgaagaa
attaaaatggaggaaggtgagatttttgctattgagacttttggtagtaccggacgtggt
gttgtccacgaagatatggaatgctctcattatgccaaaattcctgatgctggccatatc
cctcttcgtcttccccgtgccaaggctctgcttaacactattactcaaaattttggtacc
cttcctttctgtcgtagatacttggacagaattggcgaatctaagtatttgttggcttta
aataacttggtttctgcaggtatcgttcaagattacccacctttatgtgatattagagga
agttacactgctcaattcgagcatactatcattcttcaccctacacagaaggaagttgta
tcacgtggtgatgattattaa

DBGET integrated database retrieval system