KEGG   Schizosaccharomyces pombe (fission yeast): SPBC14F5.09c
Entry
SPBC14F5.09c      CDS       T00076                                 

Gene name
ade8
Definition
(RefSeq) adenylosuccinate lyase Ade8
  KO
K01756  adenylosuccinate lyase [EC:4.3.2.2]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00230  Purine metabolism
spo00250  Alanine, aspartate and glutamate metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01240  Biosynthesis of cofactors
Module
spo_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
spo_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SPBC14F5.09c (ade8)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPBC14F5.09c (ade8)
Enzymes [BR:spo01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.2  adenylosuccinate lyase
     SPBC14F5.09c (ade8)
SSDB
Motif
Pfam: Lyase_1 ADSL_C AsiA
Other DBs
NCBI-GeneID: 2539985
NCBI-ProteinID: NP_596735
PomBase: SPBC14F5.09c
UniProt: O60105
Position
II:complement(4173999..4175447)
AA seq 482 aa
MEDYGSYSTPLTARYASAEMSHLFSREMRINTWRQLWLNLAIAEKQLGLTQITDEAIEQL
KAHVKITAPEFEIAAKEEKRQRHDVMAHIYTYGLAAPAASGIIHLGATSCFVTDNADLIF
LRSAMDLLIPKLVNVINRLSQWSLRYKDIPTLGFTHYQPAQLTTVGKRATLWIQELLWDL
RNFVRARNDIGFRGVKGTTGTQASFLALFEGDHAKVEELDKLVAKLSGFDNVYPVTGQTY
DRKIDIDVLQPLASFGATAHKIATDIRLLANLKEVEEPFEAGQIGSSAMAYKRNPMRCER
ICSQARYIMNLIPNALNTASVQWFERTLDDSSNRRSLLPEAFLFTDSVLKILLNVISGMV
IYPKVIQKHIRAELPFMATENIIMAMTKHGASRHECHEQIRVLSHQAGRVVKEEGGDNDL
IERIKNTPYFAPIYDELDSLLDASTFVGRAPEQTESFVNKDVSQALAPFKSMITEEKVDL
AV
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggaggattatggttcatatagtacaccattgacagcaagatatgcttctgctgaaatg
tctcatctcttttcaagagaaatgcgtattaatacttggagacaattgtggttgaatctc
gccattgctgaaaagcaactcggtttaactcaaattactgatgaagctattgagcaactt
aaagcgcatgtcaaaattacagctccagaatttgaaatcgctgctaaggaagagaagcgt
cagagacacgatgttatggctcacatctatacatatggtcttgctgctcctgctgcttct
ggtattattcatttgggtgctactagctgttttgtaaccgataatgctgacttgattttc
ttacgcagcgccatggatcttttgatccctaagttagtcaacgttatcaatcgtcttagc
cagtggtctttgcgatacaaagacattcctactcttgggtttacacattatcaaccagct
caattaactaccgttggtaagcgtgccactctttggattcaagagcttttatgggatttg
agaaattttgtaagagctagaaatgacattggtttccgtggtgtcaagggtaccaccggc
actcaggcttccttcttagccctttttgagggcgatcatgccaaggttgaggaattggat
aaattggttgccaagctttccggttttgataacgtttatcctgtaaccggccaaacctat
gatcgtaagatcgatattgacgttttgcaaccattagcttctttcggtgctactgctcat
aagattgcaactgatatccgtctccttgctaatttgaaagaagtagaagagccatttgag
gctggtcaaattggcagttctgctatggcttacaagcgtaatccaatgcgttgtgaacgt
atttgttctcaagctcgttatattatgaacttgattcctaatgctcttaatactgcttct
gttcaatggtttgagcgtactttggatgatagctctaaccgtcgttctctgttacctgaa
gccttcttgtttacagatagcgttcttaagattctattgaacgttatttctggtatggtc
atttatcctaaggttattcaaaaacacattcgtgctgaattgcccttcatggccactgaa
aacattatcatggctatgactaagcacggtgctagtcgtcatgagtgtcacgagcagatt
cgtgtcttgtctcatcaagctggccgagtagtcaaggaagagggaggggataacgactta
attgagcgtattaagaatactccttattttgctcctatttatgatgagctagattctttg
ttggatgcatccacttttgttggacgtgctcccgagcagactgaatcctttgtaaataag
gacgtctctcaagcgcttgcgcctttcaagagcatgatcactgaggaaaaggttgatctt
gccgtttaa

DBGET integrated database retrieval system