KEGG   Schizosaccharomyces pombe (fission yeast): SPBC14F5.12cHelp
Entry
SPBC14F5.12c      CDS       T00076                                 

Gene name
cbh2
Definition
(RefSeq) CENP-B protein 2
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_1 HTH_ABP1_N HTH_Tnp_Tc5
Motif
Other DBs
NCBI-GeneID: 2539728
NCBI-ProteinID: NP_596738
PomBase: SPBC14F5.12c
UniProt: O60108
Position
II:complement(4180866..4182410)
Genome map
AA seq 514 aa AA seqDB search
MPPLRRQALTLAEKKAIRKHYFESATKPSQQELISWFEEHFHKKLAQSTVSSILSSKNEF
LDNLDAENSQIRRNRQGKYPILENALIDWQTRLQKQDGAITGNAIKKSAAELWRRIPEYS
ELPIPEFSNGWLEKFKKRCLKHGLKLQGESTSVNQGTYEENMVQIQELISLFDPKDIFNM
DETGLCWKLIPNQSPASERVKGITRDKARVTVTICCNATGSEKAPLWVIGYAKSPRAFRQ
ANAHPDSMDFHWRYNGTARMTTSIMEEWLRWFDDLMKGRKVLLILDKFVAHECALENIRN
SERKLVNTTVVFLPVNSTEIYHPCGQEIVYAFKSYYRKYWLNYMLEEIRLGKNPSKTMNV
LKAVRWMIRSWNVDFEPSIIYNCFLRSGLFQNQQPLTGPSPETIRIAVNLQELIGKYLGD
KDIFQIENFINPIEENSADTNDDIVNQVAAQFLDEREFETDEEEEESQYLLSTKDAINAI
NTLLNFQEQSEDGNVLFTRTLLQFQKVLESRSIV
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgcctccattgaggcgtcaagcgttgactttagctgaaaaaaaagcaattagaaaacat
tattttgagtcagcaactaaaccttcgcaacaagagcttattagttggttcgaggagcac
tttcataaaaagctagcacaatctaccgtttcgtcaattctatcatcaaagaacgaattt
ttagataatctagacgcagaaaactctcaaataagaagaaaccgccaaggaaaatatcct
atcttagaaaacgcccttattgactggcaaacgaggttgcaaaaacaagacggagcaatt
actggaaacgccatcaaaaaaagcgccgcagaattgtggagacgtataccggagtactct
gagcttccgattccagaatttagtaacggttggttagagaagttcaaaaagcgttgttta
aaacacggccttaagttacagggtgaatctacttcagtaaatcaaggaacgtatgaggaa
aacatggttcaaatacaggaattaataagtctttttgatccaaaagacatctttaatatg
gatgagacggggctatgctggaaacttattcccaatcaatctcctgcgagtgaacgagta
aaaggaattacgagagataaggctcgtgtcaccgtcactatttgttgtaatgctacaggt
tctgaaaaggcccctctttgggtgattggatatgctaaaagtccaagggcctttcggcaa
gcaaatgctcatcctgattccatggattttcattggcgatataatggaaccgctaggatg
accacttccattatggaagaatggcttcgttggtttgacgatttgatgaagggtaggaaa
gttctacttatactggataagtttgtcgctcatgaatgcgctttggaaaatattcgcaat
tccgagcgaaagttggtaaacacgactgttgttttccttcctgtaaattctacagaaatt
taccatccttgtggccaagagatagtctacgcttttaaatcatactacagaaaatactgg
cttaattacatgcttgaggagattcgattgggaaagaaccccagtaagacaatgaatgta
ctaaaagcagttagatggatgattcgttcttggaacgttgactttgaaccatctataata
tacaattgtttccttcgttctgggctttttcaaaatcagcaaccactgaccggtccttct
ccagaaaccattagaatcgcggtgaatttgcaagaattgataggaaaataccttggtgat
aaggatattttccaaatcgaaaattttattaaccctattgaagaaaattctgctgacact
aatgacgatatcgttaaccaagttgctgctcaatttcttgatgaacgagagtttgaaacc
gatgaagaagaggaagagtcacagtatttgttatcaacaaaggatgcgataaatgccatc
aatactttactaaactttcaagagcaatcggaagatggaaatgttttgtttactcgaaca
ttacttcagtttcaaaaggttttagaaagcagatcgattgtgtaa

DBGET integrated database retrieval system