KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1539.04Help
Entry
SPBC1539.04       CDS       T00076                                 

Gene name
tts1
Definition
(RefSeq) tetra-spanning protein 1
  KO
K20724  transmembrane protein 33
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPBC1539.04 (tts1)
   03036 Chromosome and associated proteins [BR:spo03036]
    SPBC1539.04 (tts1)
Membrane trafficking [BR:spo04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    SPBC1539.04 (tts1)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    SPBC1539.04 (tts1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0121
Motif
Other DBs
NCBI-GeneID: 2539923
NCBI-ProteinID: NP_596818
PomBase: SPBC1539.04
UniProt: Q9Y7Z5
Position
II:join(4368389..4368448,4368635..4369414)
Genome map
AA seq 279 aa AA seqDB search
MEPKQRVVKPLKERVLPVVKNTQFVWFSGQVIVLISSVLYALQAIPFRSAPPFLFKSAAF
GAIVAYAIVLYKTYSPNLTSRASWNKHFFARLMLDDNVQYFILALSMLIDRPILFSLAPY
AIYATFHISTYLRSVLLPAIYPNISDAKTASYASRVSNLLNQYTRSQFQPAMQLVASLET
FLLFRLFFGVFLRKNSISRLVGYIFFLRMRYTNSHFTRASIKAVSLRMDRLVADNRVPPV
IKNAWHTFKTYVSKFGASPVGTAQSRPTASSSTTAPSST
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggagccaaaacaacgagttgtcaagcctttaaaagaaagggttttacctgttgtcaag
aacacccagtttgtttggttttcggggcaagtaatagtgctaatctcttccgtcttgtat
gctcttcaagcaatcccttttcgttccgctcctccatttttgtttaaaagcgctgccttt
ggtgccatcgttgcatatgcaattgtcctttacaaaacttatagtccaaacttgacttcc
cgtgcttcttggaataagcatttctttgcccgtcttatgctcgatgacaatgttcagtat
tttattttagctctttcaatgttgattgatcgtcccatcctattttctctcgctccatat
gccatttacgccactttccacatctccacttacttgcgtagtgtgcttttgcctgccatt
taccctaatatttctgacgcgaaaactgcgtcttatgcttctcgtgtttctaatttgcta
aatcagtacactcgaagccaatttcaacctgctatgcaacttgttgcttctctcgaaaca
tttttattgttccgtttgttctttggggttttcttacgtaaaaactcaatttccaggttg
gtgggctatattttctttcttcgcatgagatacactaatagtcactttactcgtgcatcc
attaaagccgttagccttcgaatggatcgtttggttgcagataacagagttcctcctgtt
atcaaaaatgcttggcatacattcaaaacttatgtgtccaagttcggtgcttcacctgta
ggtactgctcaaagccgtcccactgcatcaagctctaccactgctccctcatctacttaa

DBGET integrated database retrieval system