KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1539.10
Entry
SPBC1539.10       CDS       T00076                                 

Gene name
nop16
Definition
(RefSeq) putative ribosome biogenesis protein Nop16
  KO
K14839  nucleolar protein 16
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spo03009]
    SPBC1539.10 (nop16)
Ribosome biogenesis [BR:spo03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    SPBC1539.10 (nop16)
SSDB
Motif
Pfam: Nop16
Other DBs
NCBI-GeneID: 2539893
NCBI-ProteinID: NP_596824
PomBase: SPBC1539.10
UniProt: Q9Y7Z1
Position
II:join(4380486..4380631,4380754..4381237)
AA seq 209 aa
MANPRQRNKQRSGKPRLTRRNANKKAKAKIYGNFVIQQNWDKHATLRQNYARLGLLATPN
YVTGGVEKLYPDPKRENEDRELTSEELDELKKSLPPGQAIVRRDDDGNIIEIIHGEAKTL
DDVLDKEISIAPAKTEVVRQLEEEAVKKAARQSNKMLPLSAFEHAYIQRLINKYGTEDFE
SMAKDVKLNSKLFNGSKLKNLYIRMKATK
NT seq 630 nt   +upstreamnt  +downstreamnt
atggcaaaccctagacaaaggaataagcaaagatctggaaagcctcgtttaaccaggcgt
aatgctaacaaaaaggcgaaggccaaaatttacggaaattttgtgattcaacaaaattgg
gataaacatgcaaccttaaggcagaattatgcgaggttgggtcttttagctactcctaat
tatgttacgggaggtgttgagaagctttatcctgatcctaaacgtgaaaatgaggatcgt
gagcttacctcagaggaattggatgaattgaaaaaatctttaccacctggtcaagcaatt
gttagaagagatgatgacggaaatattattgagattattcacggagaggcaaaaacactt
gatgatgttttagacaaagaaattagcattgcaccggctaaaacggaggttgttcgtcaa
ctagaagaagaagctgtaaaaaaagcagctcgacagtctaacaaaatgcttcctttaagt
gcatttgaacatgcatatattcaaagacttataaataagtacggaactgaagattttgaa
agtatggccaaagacgttaaattaaattctaaattatttaacggatctaagctcaaaaat
ttgtatattcgcatgaaggctacaaagtaa

DBGET integrated database retrieval system