KEGG   Schizosaccharomyces pombe (fission yeast): SPBC15C4.02
Entry
SPBC15C4.02       CDS       T00076                                 
Name
(RefSeq) ABC1 kinase family protein
  KO
K08869  aarF domain-containing kinase
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spo01001]
    SPBC15C4.02
Protein kinases [BR:spo01001]
 Serine/threonine kinases: Other
  ABC1 family
   SPBC15C4.02
SSDB
Motif
Pfam: ABC1
Other DBs
NCBI-GeneID: 2539608
NCBI-ProteinID: NP_595922
PomBase: SPBC15C4.02
UniProt: O60111
Position
II:join(2238826..2239248,2239362..2240344,2240437..2240704)
AA seq 557 aa
MFSRFSWPRITRCFRSYPKKKSSCISFTHHAREHTNFKKPAVVGASITLMASVALVDFDP
VKHAGVSSKRAYRVVLAGFLCFSDYKKVLGSSYASEEERQLALSECHLRCAERSLKVFEE
NGGIYIKIGQHLSAMGYVIPKEWTNTMVKLQDRCPSTSLKDIDHLFRVDTGKGLDETFDE
FDPIALGVASLAQVHKARLKDSDVWVAVKVQHPSVSLNSPLDLSMTRWVFKAIKTFFPDF
KLMWLADEIERSLPQELDFTREAKNSIETKEHFAHLSTSLYVPEVMWSKPRILVMEYVAG
ARIDNLSFMDEHSISRDLVSVDICHIFNEMIFGKGGHLHCDPHGGNVLIRSKPKNSKSPR
NYEIVLLDHGLYRDIPHELQVDYANMWLNIINFNEKNLKFYAKKVANVSDENFPIFATAI
TGRPYKSLKSLPIGGPNHEEEQKKFISALQKGGMLQSIIRLLSTMPRLTLLLMKTNDLVR
SLDENLKTKSGPEKLYLIMARYCLRCVYDDKMDSLWNSRSFWVSKVFKGTYYRLSYLFSS
LKYTLAENYFYYKHMYL
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgttttctcggttttcctggccaagaattactcgttgcttccgatcatatccaaaaaag
aaatcatcatgtatttcttttactcaccatgctcgggagcatactaattttaagaaacct
gctgttgttggcgcttcaattactttaatggcatctgttgcgctagtagactttgatcct
gtaaagcatgcaggtgtatcatctaaaagagcatatcgtgttgttttggctggatttctt
tgcttttctgattacaaaaaagtacttggttcttcgtatgcttcagaagaggagcgtcag
ctagcattgagtgaatgccatttgcgatgtgcagaaagatctttaaaggtctttgaagag
aatggaggtatatatattaaaattgggcagcatttgtctgctatgggttatgtaattcca
aaggaatggaccaatacaatggtgaaattacaagatcgttgtccgtcaactagtctgaag
gatatagatcaccttttcagagtcgacactggtaaaggtcttgacgagacgttcgatgaa
tttgatcctattgcacttggtgtagctagtttagcacaagttcacaaagcaagacttaaa
gattcagatgtttgggttgccgtcaaagtgcaacatccctctgtcagtttaaattcacct
ttagatctttccatgacaagatgggtgtttaaagcaattaaaacctttttcccagatttc
aaattgatgtggttagccgacgaaatagaacgttctctgcctcaagaattagacttcacc
cgtgaagcaaagaatagtatcgagacaaaagagcattttgctcacttatctacttcacta
tatgttcctgaagtcatgtggtcgaagcctagaatattggtcatggagtacgttgcgggt
gcccgaatcgataatttatcgtttatggatgagcatagtatttctagagatcttgtctct
gttgacatttgtcacatttttaatgaaatgatttttggaaaaggcggtcatttgcattgt
gatccacatggtgggaacgtcttaattcgttcaaagcctaagaactcaaaatcaccaagg
aattatgaaattgttcttcttgatcatggtttatatcgtgatattcctcatgaacttcaa
gtggattatgcaaatatgtggctcaacattattaatttcaacgaaaagaacttaaaattt
tatgctaaaaaagtagccaatgtttccgacgagaattttcctatctttgcgactgctatt
acagggaggccttataaaagcttgaaaagtttaccaattggcggccctaatcacgaagaa
gagcagaaaaaatttatatctgctttgcaaaaaggtggaatgcttcaaagtataattcgc
cttttgagcactatgcctcgattaacattactcttaatgaaaacgaacgatttggtaaga
tcacttgatgaaaatttgaaaactaaaagcggtccagaaaaattgtatttaattatggct
cgttactgcttaagatgcgtgtacgatgacaagatggactcactatggaattcacgctca
ttttgggtttctaaagtatttaagggaacgtattataggctcagctatttattcagctct
ttaaagtacacccttgctgaaaactacttttattataaacacatgtatctatga

DBGET integrated database retrieval system