KEGG   Schizosaccharomyces pombe (fission yeast): SPBC15D4.05
Entry
SPBC15D4.05       CDS       T00076                                 

Definition
(RefSeq) putative nucleotide-binding domain-containing protein CobW/HypB/UreG
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: cobW CobW_C TsaE MMR_HSR1 AAA_16 AAA_22
Other DBs
NCBI-GeneID: 2539606
NCBI-ProteinID: NP_596245
PomBase: SPBC15D4.05
UniProt: O74310
Position
II:3020853..3022088
AA seq 411 aa
MDFEIENESEIPQLVDVEEVNTQPHSETLSVPTVSSNNDIDSFEQQSDFLLVDHDSTLDP
VPVTILTGFLGAGKTSLLRSILENRNGKRVAVLMNEVGDSGDLERSLMEDVGGEELYEEW
VALSNGCMCCTVKDNGIKALEKIMRQKGRFDNIVIETTGIANPGPLAQTFWLDDALKSDV
KLDGIVTVIDCKNIDNILKDESDIGFIQISHADCLILNKTDLISSEALSVVRQTILKINC
LAKIIETTYGRLDDISEILDLDAYGNENTSNLEWSIQRSNDSNINCSTCLDVDCQHLHSL
DTHSLDISTHTFKLPPLMSKEVFQQFLQWVRHTLWSCLEEGEDEEFMIYRSKGIFNKDDG
SWYIFQGVREVFEIMPLSEKPRAFLEKDIHPEIILIGRNLHRISPFVVGNQ
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggactttgaaattgaaaacgagtcggaaattccacagctggttgacgttgaagaggtt
aacacacaaccgcattcggaaacattaagcgtacctacggtttcgtccaataatgatatt
gattcatttgagcagcaatcagattttcttctagttgatcatgactctaccttggaccca
gtccctgtcacaatactgacgggctttttgggtgccggtaaaacttctttgctacggtca
attcttgaaaatcgaaatggtaaaagggttgctgtattaatgaatgaggtgggtgattcg
ggagaccttgaaaggagcttaatggaggatgttggaggagaagaactttatgaagagtgg
gtggctctttcaaatgggtgcatgtgttgcactgtgaaagacaatgggattaaagctttg
gaaaaaattatgaggcaaaaggggagatttgataacattgtaattgaaacaacgggtata
gccaatcctggtcctcttgctcaaacattttggttggacgacgcgttgaaaagcgatgtc
aagttagatggcatcgttactgttattgattgtaaaaatatagataatatcttaaaggat
gaaagtgatattggttttattcaaatttcacatgctgattgtttgatcttaaacaaaaca
gatcttatttcttctgaagcattatctgtggtacgtcaaactatattgaagatcaattgc
ttagcgaagattattgaaacaacatatggacggttggatgacatttctgaaattttggac
ttggatgcatacggcaacgaaaatacttctaatcttgagtggtcgattcaaaggagcaat
gatagcaatattaattgttctacttgtttggacgtggattgccaacatttgcattctctc
gatacgcatagccttgatatctcaactcatacttttaaactgcccccactaatgtcgaaa
gaggtttttcagcaatttctacaatgggttcgtcatacactttggtcttgtttggaggaa
ggggaagacgaggagtttatgatttatcgaagtaaaggaatttttaataaagacgatggc
tcttggtacatctttcagggtgttcgcgaagtattcgaaattatgccgctgtcggagaag
cctcgagcatttttagaaaaggatatccatcccgaaattatcctaattgggcgtaatcta
catcgaatatctcctttcgtcgtcggaaaccaataa

DBGET integrated database retrieval system