KEGG   Schizosaccharomyces pombe (fission yeast): SPBC15D4.14Help
Entry
SPBC15D4.14       CDS       T00076                                 

Gene name
taf73, taf5, taf5l
Definition
(RefSeq) transcription initiation factor TFIID subunit taf73
  KO
K03130  transcription initiation factor TFIID subunit 5
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    SPBC15D4.14 (taf73)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:spo03021]
    SPBC15D4.14 (taf73)
   03036 Chromosome and associated proteins [BR:spo03036]
    SPBC15D4.14 (taf73)
Transcription machinery [BR:spo03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     SPBC15D4.14 (taf73)
   Coactivators
    SAGA/TFTC/STAGA complex
     SPBC15D4.14 (taf73)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    PCAF complex
     SPBC15D4.14 (taf73)
    STAGA complex
     SPBC15D4.14 (taf73)
    TFTC complex
     SPBC15D4.14 (taf73)
    SAGA complex
     SPBC15D4.14 (taf73)
    SLIK complex
     SPBC15D4.14 (taf73)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40 TFIID_NTD2 ANAPC4_WD40 Ge1_WD40 Nup160 LisH
Motif
Other DBs
NCBI-GeneID: 2539882
NCBI-ProteinID: NP_596254
PomBase: SPBC15D4.14
UniProt: O74319
Position
II:join(3033881..3035353,3035410..3035865)
Genome map
AA seq 642 aa AA seqDB search
MAQSSYSSGNSTSDLNKIVLDYLFKKGYSRTEAMLRLEISSVGAIPEEQQDWHIGASETY
VQVYILLRDWIDGTLDLYKPKLQKVLYPIFVHSYLDLLQKNDPEMAIYFFESFRIEHEVL
HGYDIRALAQLKIASDVEEIEIAQLYRKNKYRINFTRSTFDLLVQFLFENEVNGSGIIIR
LLNQYIDIKITMPQVEGKEDPNVQAVYEMDEAKNEQTIISEQEGIPGHSEQLLDYNKQSI
QLGLRPLSEEVVTTLKNLLEVKDKDVEGRNEALNKILHPAKNLVELLTEKENLINESTLE
SPSDPPLPPTKMKDIDYFVSLLESEQNSLILGKNATDPSVFMYTMHNTLSAVNCAAFSDD
ASMFALGCADSSIHLYSSTNNGPQPLVGSQNEPLQKSSLIGHTRPVFGVSISPQKEFILS
CSEDGFTRLWSKDTKSTIVKYAGHNAPIWDVQFSPFGYYFATASHDQTARLWDVEHAAPL
RVFVGHQNDVDCVSFHPNAAYLATGSSDHTTRMWDVRTGGTVRVFNAHHSPVSALCMSAD
GLSLASADESGIIKVWDLRSSNQHVSFVKHSSIVYSLSFSYDNKILVSGGADTDVNFWDL
TYRNNLSDGEQSPLLFNFKTKNTIIQNLSFTRRNYCLALSSS
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggctcaatcttcctactcttctggtaattcaacttcagatttaaacaagattgttttg
gactatctgtttaaaaagggttattccaggactgaagctatgcttcggttggaaatatcc
agtgttggcgcaattcctgaagaacagcaagactggcacatcggtgcttctgaaacttat
gtacaagtttatattttattaagagattggattgatggtacattagatttgtataagcca
aaactacaaaaagtcctttatccaatttttgtacactcttacttagacttactgcaaaaa
aatgatcccgaaatggcaatatacttctttgaatcatttcgtatagagcatgaagtgttg
catggctatgacattcgagcattagctcagttgaagattgcatcagacgttgaggagata
gaaatagctcagctttatcgcaaaaataaataccggattaatttcacgaggtctacattt
gatttactagtacagtttttgttcgaaaacgaagtcaatggaagtggaataataattcgc
ttattgaatcagtacattgatataaaaattactatgcctcaagtcgagggcaaggaggac
cctaatgtgcaagcggtctatgaaatggacgaagctaaaaatgaacagacaataattagt
gagcaagaaggaattcctggccattccgaacagcttcttgattacaacaagcaaagcata
caacttggattacgtcccttgtcagaagaagttgtcacaactttaaaaaacttgttagaa
gtaaaagataaagacgtggagggaagaaatgaagctctgaataaaatattgcatcctgca
aagaaccttgtcgaattgctgactgaaaaagaaaatctaatcaacgaatcaactctagaa
tcaccatctgatcccccattacctccaaccaaaatgaaggacatagactattttgtttct
ttactggaaagcgaacagaattctttaatactcggaaaaaatgctacggatcctagtgtt
ttcatgtataccatgcacaatacactttccgctgtaaattgtgctgcattctctgatgac
gcctctatgttcgctctgggttgcgcagactcttcaattcatttgtacagttctactaac
aatggtccgcaaccattagtgggaagtcaaaatgagcctttacaaaagtcctctttaatt
ggacatacgagaccagtttttggagtgagcatctctcctcaaaaagagtttatactgtca
tgctctgaggatggctttactcgtttgtggtccaaggatactaagtccactattgtcaaa
tatgctggtcataatgcgccgatttgggacgttcagttttcccctttcggctattatttt
gcaacagcctcgcacgaccaaacagcacgtctatgggatgttgagcatgcagcacctttg
agagtatttgttggacatcaaaatgatgtggattgtgtttcatttcatccgaatgcagct
tatcttgctacaggatctagtgatcatacaactagaatgtgggacgttcgcactggtgga
acagttcgcgtgtttaatgcccatcattctcctgtttctgcattgtgtatgtctgctgat
ggcttatcgttggcatctgctgatgaatcgggcataataaaagtgtgggatctcagaagt
agtaatcagcacgtttcattcgttaaacactctagtatcgtttattctctttctttttca
tatgataacaaaattctggtttccggaggtgcagatactgatgttaacttttgggatttg
acataccggaataacttatcggacggcgaacagtccccgcttttattcaattttaaaacc
aaaaatactattatacaaaacttaagttttactcgaagaaactattgtctagcattaagc
tcttcctaa

DBGET integrated database retrieval system