KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1604.04
Entry
SPBC1604.04       CDS       T00076                                 

Definition
(RefSeq) putative thiamine pyrophosphate transporter
  KO
K15108  solute carrier family 25 (mitochondrial thiamine pyrophosphate transporter), member 19
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPBC1604.04
Transporters [BR:spo02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   SPBC1604.04
SSDB
Motif
Pfam: Mito_carr SLC25_like Phage_holin_8
Other DBs
NCBI-GeneID: 2540155
NCBI-ProteinID: NP_596636
PomBase: SPBC1604.04
UniProt: O94370
Position
II:complement(join(3924320..3924389,3924483..3925172,3925219..3925310))
AA seq 283 aa
MGLAKQKDSQEFAQPVWHYTLAGGISSVICRFMIAPFDVIKIRMQITQSSLRPVFKETVQ
KEGVRALWRGNVVAELLYLVYGAAEFVAFSKLKHLTENLAMNDHAVNFLCGTSAGIFATL
TSYPLDTMRTKFASYAKTPHMLPATKKIYAEAGIKGFFPGLKFSVIQIGPYAGCFFMFYR
ASEAVLSPLGLALSSTLSGVIAGAGSKAIMFPVDTVVKTLQTFPSNYKSFKDCFLSIYRN
SGIKGLYRGLSVSMLKVAPGRAITMLIYEQTLQGLRTLSSPEA
NT seq 852 nt   +upstreamnt  +downstreamnt
atgggccttgcaaagcaaaaggactcgcaagagtttgcccaacctgtttggcattacact
ttggctggtggcatttcatccgtaatttgtcgatttatgatagcaccatttgatgtgata
aaaattcgtatgcaaattacccagtcttcgttgaggccggtctttaaagagactgttcag
aaggaaggcgtacgagctttgtggagaggaaacgtggttgctgaactgctttacttagta
tatggtgctgccgaatttgtggctttttcaaagttaaaacatttaacagagaatctcgct
atgaatgaccatgcagtcaactttctgtgtggaacttcagcaggaatttttgctacactc
acgtcctatccacttgatacaatgcgtacaaagtttgcttcttacgccaagacacctcat
atgcttcctgctacgaaaaaaatttacgcagaagcaggcatcaaaggtttttttccagga
ctcaaattctccgtcatccaaatcggtccttacgcaggatgcttcttcatgttttataga
gcatcagaggccgtcttgtcgcctctgggtcttgcgctcagctctaccttgagtggggtc
atcgccggcgctggatcaaaagctatcatgtttccggtcgacaccgtagtaaaaacttta
caaaccttcccctcaaactataaatcgtttaaagattgcttcctttccatctatcgtaac
tctggaatcaaaggactgtatagaggtttatcagtcagcatgcttaaagttgcgcctgga
agagcaattactatgcttatatacgaacaaactctacagggacttcgcacactgtcctct
ccggaagcttaa

DBGET integrated database retrieval system