KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1604.06c
Entry
SPBC1604.06c      CDS       T00076                                 

Definition
(RefSeq) putative Mak21 family protein
  KO
K14771  U3 small nucleolar RNA-associated protein 19
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spo03009]
    SPBC1604.06c
Ribosome biogenesis [BR:spo03009]
 Eukaryotic type
  90S particles
   U3 small nucleolar RNA-associated proteins
    SPBC1604.06c
SSDB
Motif
Pfam: CBF
Other DBs
NCBI-GeneID: 2539987
NCBI-ProteinID: NP_596634
PomBase: SPBC1604.06c
UniProt: O94372
Position
II:3920073..3921530
AA seq 485 aa
MIKDLENEIYKSRKNLNNILVLFDYIDLSNHSIDEVNDAAAALCRVYCYLSRNGLLKRPK
EDDSSANAQVKNWVCDNYINYTEKLTEIFSMANVEALQVSFLTMTMRLCKAESQMDENGT
FRNQFYIRFCLELLSSSQLSDICIKDFVTSYLVPYDDVRFFFYKNSKKVISSLIESSKTD
DPMANLDIVAFNTIRILSAIPSPLPSSSTSSWADEPSPSSTETSSIKRAFQESWLSALSL
PLSVNLYKQVLNVIHKRVIPFLQKPNLLMDFLTDAYNSHHAVSLLALNGLFTLMISHNLD
YPLFYPKLYALLDRNLLYLKTRSRFFRLLDLFLSSTHLPATLIASFIKRLARLALTAPPG
AIAIVIPFIYNCLQRHPTCMQMLHRSSAESGDSFDFDQPDPLLTGAIESSLWELSTLQNH
YYSNIASLASIMSQKFTKPRYELEDFLDHGYATMCDAELRRPLKNEPPIEFEKRTLASGL
EKSWI
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgataaaggatctcgaaaatgagatatataaatcaaggaagaatttgaacaacattttg
gtactatttgattatatagatttatcgaatcattctatcgatgaggttaacgatgcagcc
gcagccttgtgtcgtgtatattgctacctttcacggaatggattgttaaaaagaccaaaa
gaagacgattcttccgcaaatgctcaagtgaagaattgggtttgcgacaattatatcaat
tatactgaaaaattaactgagattttttcaatggctaatgtggaagctttgcaagtttcg
tttttgacaatgacaatgcgtctttgcaaagcagaatctcaaatggacgaaaatggtaca
tttagaaatcaattttacataaggttttgtttggaactgctttcttcaagtcagctttct
gacatctgcattaaagattttgtcacttcctatttggtcccctatgatgatgtacggttc
tttttttacaaaaattctaagaaggttatctcatcgttaattgaaagttctaaaacagat
gatcccatggctaatttagacattgtggcctttaacactattcgaattctttcagccatc
ccgtctccattgccttcttcctctacatcttcttgggcggatgaaccctctccaagctcc
actgaaacatcatccattaaacgtgctttccaagagtcttggctctcagctttatcactc
ccactaagcgtaaatctgtataaacaggttttgaacgttatccataaacgggtaattcct
ttccttcaaaaaccaaaccttcttatggactttcttaccgatgcttataattcccatcac
gccgtatctttattggctttaaacggtcttttcactctgatgataagtcataatcttgac
tatccattgttttatccaaagctatacgctttgttagatagaaatttactgtatttaaag
acaaggtcgagattttttcgtttattggatttatttctttcgtcaacccatcttcccgca
acattgatagcctcgtttataaaacggcttgctcgccttgctttaacggctccaccagga
gcgattgccatagtgatcccatttatttacaactgtcttcagagacacccgacctgcatg
cagatgttacaccgttcttctgctgaatccggggattccttcgattttgaccagccagat
cctttgcttactggcgctatcgaatcatcgttgtgggagctaagtacgttacaaaatcat
tattattccaacatagctagtttggccagcattatgagtcaaaagtttacgaagcctcgc
tatgagttagaggattttcttgaccatggatatgccactatgtgcgatgctgaactccgt
aggccattgaagaatgaaccacctatagagtttgagaagcgcacattagcatctggtctc
gaaaaatcatggatttag

DBGET integrated database retrieval system