KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1652.02
Entry
SPBC1652.02       CDS       T00076                                 

Name
(RefSeq) putative APC amino acid transporter
  KO
K16261  yeast amino acid transporter
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPBC1652.02
Transporters [BR:spo02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   SPBC1652.02
SSDB
Motif
Pfam: AA_permease AA_permease_2 Spore_permease
Other DBs
NCBI-GeneID: 2540163
NCBI-ProteinID: NP_596769
PomBase: SPBC1652.02
UniProt: Q92367
Position
II:4256509..4258293
AA seq 594 aa
MTSFTESKKLDEIESPVPEIIVPSTTNGNGTIESYKEKSVGTSFLDFFRSYKLRPDNEFA
EVHNSEDFLKPRHLQMIAIGSCIGTGLFVSTGKSLKNAGPGSLMINFIILSAMILALILS
LGEMCCFLPNQSSITMYTGRLLNNNIGFAQSWLYFWIWLTVLPSEISAACEVVDFWTTQH
LNPAIWVTIFLAYVVLVNAFGARSYGECEFVSSFLKVVIVIIFFFVAIIINCGAAPKGGY
IGAHYWHHPGSFRNGFKGFCSVFISSAYSLSGTENIGTAAGNTSNPQRAIPSAVKKVFYR
MGFFYIITIFLITLVVPYDNPDLGNVSPFIIAIKNGGIHVLPHITNAVILVSVLSVGNAA
VFAASRNAMALVKQGWAPRFLGRVDQKGRPVISYLCSLAMACIAYVNAAPDGSVVFDWLM
SVSGGGAFVIWGLSFIDHIRLRYAMKAQKIPDTVLPYKFPGSVYLSYYGVLINFLALCAL
VYISIFPVTHEKPSAYGFFVSFLGPSVFIAYLLISPIFVKPTFQSLKDVDLTTGRYDLVN
SQMYVAESSTSELSEKDLTKPNLQSNDNKNSEDLESNTPPQKKSALQKVADFLC
NT seq 1785 nt   +upstreamnt  +downstreamnt
atgacttcgtttacggaatcaaaaaaactggatgaaatagagtcgccagttccggaaatt
attgttccaagtaccaccaatggaaacggaacaattgaatcttacaaagaaaaatcggtt
ggaacctctttcttggatttttttcgctcctacaagttgcgcccagacaatgagtttgct
gaagtgcacaacagtgaggactttttgaaaccgaggcatttgcaaatgatcgccattggt
agctgtattggtacgggtctttttgtttccactggcaaatctttaaaaaacgctggaccg
ggaagtctaatgattaatttcattatcctcagcgcaatgattctcgctttaattctttct
ctaggagaaatgtgttgtttcctaccaaatcaaagtagtatcacaatgtacactggacga
ttgttaaataataacattggttttgcgcagtcatggttatatttttggatatggctgacc
gtcttgcctagtgaaatctctgccgcttgcgaagtagttgacttttggacaacacagcac
ttaaacccagctatttgggtaactatcttcttggcttatgttgtcttagttaatgcattt
ggagcccgtagctatggtgaatgtgaattcgttagttcatttttaaaagtcgtcattgtt
atcatcttcttcttcgttgcaattatcatcaactgtggagctgctccaaaaggtggctac
attggtgcgcactattggcatcatccaggatcgtttcgtaacggtttcaaaggtttttgc
tccgtatttatttcctcagcctattcgttgtcgggtactgagaacataggtacggctgct
ggaaataccagcaatcctcaacgtgcaattccaagtgctgtgaaaaaggtgttctaccgt
atgggcttcttctacatcatcaccatcttcttgatcactttagtagtcccgtatgataac
ccagacctgggtaatgtcagtccattcattattgcgatcaagaatggaggaattcatgta
ctaccacatatcaccaatgctgttattctcgtttccgttctctctgtaggtaatgcagct
gtattcgcagcgtctcgcaatgcaatggcgttggtaaagcaaggatgggcaccacgtttc
ctaggtcgtgtagatcaaaagggacgtcccgtaatttcatacttgtgttcgctagccatg
gcttgtattgcttacgttaatgctgcacctgacggttctgttgtgttcgactggctaatg
tctgtctcgggtggaggagccttcgtaatttggggactttcttttatcgatcacatccgt
ttgcgatatgcaatgaaggctcagaaaattccagacactgtcttaccatataagtttcct
ggaagcgtttatcttagctactatggagtccttatcaattttttagcactctgtgcactt
gtatacatttcgattttcccagtaacacatgagaagccgagtgcatacggcttctttgtt
tcatttttaggaccgtctgtttttatcgcttatcttctgattagtccgattttcgtgaag
ccaacgtttcaatccctaaaggatgtagaccttacaacgggccgttatgatttggtaaat
tcacaaatgtatgtagctgagtcgagcacttcggaattaagtgaaaaagatctaaccaag
ccaaacctccaaagcaatgataataaaaatagtgaagatctcgaaagcaatactcctcca
caaaagaaaagcgcgttacagaaagttgccgacttcctttgctag

DBGET integrated database retrieval system