KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1683.09c
Entry
SPBC1683.09c      CDS       T00076                                 

Gene name
frp1
Definition
(RefSeq) Fe(3+)-chelate reductase Frp1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: FAD_binding_8 NAD_binding_6 Ferric_reduct LapA_dom
Other DBs
NCBI-GeneID: 2539711
NCBI-ProteinID: NP_595065
PomBase: SPBC1683.09c
UniProt: Q04800
Position
II:complement(160461..162155)
AA seq 564 aa
MAINSSDKWTVIAICLILGILLAFILMFWLERFRVIIKSNAHKHDPSDKRQIWLEKYYLF
VRQIYTYLVTHKVILTLIAVPVVFAISIPFIGMQTPASSHGKQTTQVSTGNWSKNAVAAR
LGFLACGLYVTSYFFSIKNNPFALLLISSHEKMNYVHRRLSQYAIMIGAIHGFAYIGLAA
QGKRALLTARVTIIGYVILGLMVIMIVSSLPFFRRRFYEWFFVLHHMCSIGFLITIWLHH
RRCVVYMKVCVAVYVFDRGCRMLRSFLNRSKFDVVLVEDDLIYMKGPRPKKSFFGLPWGA
GNHMYINIPSLSYWQIHPFTIASVPSDDFIELFVAVRAGFTKRLAKKVSSKSLSDVSDIN
ISDEKIEKNGDVGIEVMERHSLSQEDLVFESSAAKVSVLMDGPYGPVSNPYKDYSYLFLF
AGGVGVSYILPIILDTIKKQSRTVHITFVWSARSSALLNIVHKSLCEAVRYTEMNINIFC
HLTNSYPVEEVSSLNSQSARNYSLQYLNGRPDVNDYFKDFLHATGTQTAALASCGSDKLL
RHLKSCVNTHSPSTVDLYQHYEEI
NT seq 1695 nt   +upstreamnt  +downstreamnt
atggcgataaattcgagcgacaaatggaccgtcattgcaatatgcttaattcttgggata
ttacttgcatttatattgatgttttggcttgagcgttttcgggtcataataaaatcaaat
gcacacaaacatgacccatcagataagaggcaaatatggctcgagaaatattatcttttt
gttcgacagatttatacgtatcttgtcactcacaaagtaatattgactttaattgctgtt
cctgtcgtcttcgccatctcaataccatttattggcatgcaaactcccgcaagctctcac
ggaaagcaaacaacacaagtaagtactggtaattggagcaaaaatgcagtggccgctcgg
ttaggatttttggcatgtggcctctatgtaacttcctacttttttagcataaaaaacaat
ccttttgctttattgctcatttcgtctcacgaaaaaatgaattatgtgcatcgtcgtctt
tctcaatatgcaattatgatcggtgctattcacggctttgcatacattggtcttgcagcg
caaggtaaaagggcacttcttactgcaagagtcaccattatcggttatgttattttaggg
ttaatggtaattatgatcgtaagcagcttgccatttttccgtcgaagattttacgaatgg
ttttttgttttgcaccatatgtgcagcattggctttttaattactatttggctccaccat
cgaaggtgtgtggtttacatgaaggtctgtgttgccgtgtacgtgtttgatcgtggctgc
agaatgctaagaagctttttaaatcgttccaaattcgatgttgttttggtggaagacgat
ctcatctatatgaaagggcctcgtccaaaaaaatctttctttggattaccttggggtgct
ggaaaccatatgtatattaatattccctctttaagttattggcaaatacatccattcacg
attgcgagcgttccttccgatgattttatcgaactatttgtcgcagtaagggctggtttc
acaaagcgattagccaagaaggtctcttccaaaagtttgagtgatgtctccgacatcaat
attagtgatgagaagatagaaaaaaatggagacgttggaattgaagtgatggaaagacat
tcgttatcacaggaagacttagtcttcgaaagttcggctgccaaagtatcggtactaatg
gatggcccttacggcccagtctcaaacccatacaaagattattcttacctctttttgttt
gctggaggtgttggagtttcgtatatcttaccgattattttggatactataaaaaagcaa
agcagaaccgttcatataacttttgtttggtctgctcgttcttcggctttattgaacatc
gtgcataagtcactttgtgaagctgttcgttacacagaaatgaatatcaacatattctgc
catttgactaacagctaccctgtcgaggaagtctcttctctaaactctcaaagtgctaga
aattacagtttgcaatacctaaatggaaggcctgatgtaaatgattattttaaagatttt
ctgcatgcaactggtactcaaacagccgctcttgcatcatgcggctcggataagcttctg
agacatcttaaaagctgtgtcaatacacactcaccttccactgtcgatctttatcaacac
tatgaagaaatttga

DBGET integrated database retrieval system