KEGG   Schizosaccharomyces pombe (fission yeast): SPBC1685.13
Entry
SPBC1685.13       CDS       T00076                                 

Gene name
fhn1
Definition
(RefSeq) Fhn1 plasma membrane organization protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: MARVEL
Other DBs
NCBI-GeneID: 2539727
NCBI-ProteinID: NP_595217
PomBase: SPBC1685.13
UniProt: O74333
Position
II:526091..526642
AA seq 183 aa
MVGIRQYGVFTWVFRTFQLAIDTIVLALASALVNQQTSGGSPGKINFSVAVGSFAILTFF
LTAVGRFLPTILGNPWLIAFYDFVNWVFALTGGCCIAVAIRVHACDNQKYLDRNHYTQGS
MRRCQELKALCFFLWFMFGLYVASFIVQIFIAKNDTPNYTFRGRGRGKGSGPAVAPRPVM
SAV
NT seq 552 nt   +upstreamnt  +downstreamnt
atggttggaatcagacaatacggtgttttcacctgggttttccggactttccaattggcc
attgataccattgtcttggctttggcttctgcccttgtcaatcaacaaacctccggtggc
tctcccggtaagattaacttttccgtcgccgttggctcctttgccattctcaccttcttc
cttactgccgtcggtcgcttccttcccaccatcttgggtaatccttggttgattgccttt
tacgactttgtcaactgggtctttgcactcaccggtggttgctgtatcgccgtcgccatt
cgtgtccatgcttgcgacaatcaaaaatatctcgaccgcaaccactacacccaaggttcc
atgagacgttgccaagagttgaaggccttgtgtttcttcctttggtttatgtttggtctc
tatgttgcttccttcattgttcaaatcttcattgccaagaacgacactcctaactacacc
ttccgtggtcgtggtcgtggaaagggaagtggccctgccgtcgcccctcgccccgtcatg
tctgccgtttaa

DBGET integrated database retrieval system