KEGG   Schizosaccharomyces pombe (fission yeast): SPBC16A3.09cHelp
Entry
SPBC16A3.09c      CDS       T00076                                 

Gene name
ufd1
Definition
(RefSeq) putative Cdc48-Npl4-Ufd1 complex subunit Npl4
  KO
K14016  ubiquitin fusion degradation protein 1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SPBC16A3.09c (ufd1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UFD1 Spa1_C
Motif
Other DBs
NCBI-GeneID: 2539623
NCBI-ProteinID: NP_596780
PomBase: SPBC16A3.09c
UniProt: O42915
Position
II:join(4282154..4282156,4282204..4282372,4282553..4282585,4282642..4282763,4282812..4283513)
Genome map
AA seq 342 aa AA seqDB search
MFGGSFFSSDDDGFSMMSQLRSAFHNNVNQRFDTRYRCYPVAMIPGEERPNVNYGGKVIL
PPSALEKLSRLNVSYPMLFDFENEAAEKKTHGGVLEFIAEEGRVYLPYWMMTTLSLEPGD
LVRVINTDIAQGSYVKLQPQSVNFLDITDHRAVLENALRNFSTLTKSDIFEILYNDQVYQ
IKVIDVQPDDSRHVVSVVETDLVVDFDPPIGYEESLQKNKQQNIAGVQGTMVTKIGYDEL
VRQGDSNLMKGTGTKLNGKEVAEVPKINLLDVEKQECPAPLILPLGTYFFGYPYKAPSIE
EDSKKDPNLFKFEGAGTSLRASRKTNGTMGKGSSDDPIDIDA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcggcagctttttctcaagcgacgatgatggtttctccatgatgtctcaactt
cggtcagcttttcataataatgtaaatcagcgatttgatactcgttaccgctgttatcct
gttgccatgattcctggtgaggaacggccaaatgtcaattatggtgggaaagtaatatta
ccaccttcagctttagaaaaactatcacgcctgaatgtcagttatcccatgctttttgac
tttgaaaacgaagctgcagagaaaaaaactcatgggggtgtgttagaatttattgcggaa
gagggacgtgtctacctgccttattggatgatgactacacttagccttgagcctggagat
ttggttcgagttataaatactgatatagcacagggcagctatgtcaaattacagcctcaa
agcgtgaattttcttgatatcacggaccacagagcggtattggaaaatgcgcttaggaat
ttcagtacgcttacaaaatctgatatatttgagattttgtataacgaccaggtatatcaa
ataaaagttatagatgttcaacctgatgactcccgccatgttgtctcagtggtagaaacc
gatttggtagttgattttgatccccccatcggttatgaagaaagtttgcaaaaaaacaag
cagcaaaatattgctggcgttcaaggaacgatggttaccaagattggttacgatgagctg
gtgaggcagggcgattcgaatttgatgaagggaacagggactaaactaaatggtaaagaa
gttgctgaagtgcctaaaataaatttgctcgatgttgagaaacaagaatgtcctgctccg
ttgatcctaccattgggtacatacttctttgggtatccttataaagcaccctctattgaa
gaagattctaagaaagaccccaatttatttaagtttgaaggtgccggtacatctctacgt
gcctctcgcaaaacaaatggaacaatgggaaaaggttcctctgatgacccaatcgatatt
gatgcttaa

DBGET integrated database retrieval system