KEGG   Schizosaccharomyces pombe (fission yeast): SPBC16A3.13
Entry
SPBC16A3.13       CDS       T00076                                 
Symbol
meu7
Name
(RefSeq) alpha-amylase 4
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00500  Starch and sucrose metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SPBC16A3.13 (meu7)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SPBC16A3.13 (meu7)
SSDB
Motif
Pfam: Alpha-amylase A_amylase_dom_C
Other DBs
NCBI-GeneID: 2539749
NCBI-ProteinID: NP_596776
PomBase: SPBC16A3.13
UniProt: O42918
Position
II:complement(4272341..4274665)
AA seq 774 aa
MKLSLKDLALSIILVLGVAPPVQALSAEEWKKQSVYNVMTDRFATSKVVPHCDVKAEKYC
GGNWQGIVDHLDYIRDLGFTAISISPVVEQLEGPEYHGEAYHGHRPKNYYRLNPHFGNEE
DLKELSDALHGKGMYLMVDVAINHTISEYFEDDYFKNTYFDKTHIDHKCKEHCSCHHDKF
PRPVPHNGTKPDHKPWKHEEHCHHGKFPRPVPHNGTKPDHKPWKHEEHCSCHHDKFPRPV
PHNGTKPDHKPWKHEEHCSCHHDKFPRPVPHNGTKPDHKPWKHEEHCHHGKFPRPIPHNG
TKPDHKPWKHEEHCHHGRFPRPVPHNGTKPDHKPWKHEEHCSCHHDKFSRPVPHNGTKPD
HKPWKHEEHCHHGKFLRPVPHNVTKPDHKPWKHEEHCHHGKFPRPVPHNGTKPDHKPWKH
EEHCSCHEDHSVHERPSAKGALEDYIQTFVETFQIDGIRFDAMGDKYRKYWPDFCKAAGV
FCMGDLKSSDSLKVCDWQNDLEGLSNFPVRESAVKAFLMNNPEGIVDLADKMTDMRGLCV
NPLLLGNFVENKDLPRMASISSDPATLKNAIAFVLMGDGIPMMYNGQELAMRGEEVPYNR
PAIWEKGFPKRNPYYKFTSTINRFRKAMIESKDGEAFLNMQSDISIVDKRILLLRRGKVI
TVLNNLGSYYIHFHYTVSAEEHKWMDVLSCKSVPVQDNRQVFMVRNGEPMILYPEESAYE
MGLCPSPIQLTEDYNSEGSLSINVEEAQTSKAPEQNRGFTNVLAALLLSLLMIL
NT seq 2325 nt   +upstreamnt  +downstreamnt
atgaaattgtcattgaaggatctcgcattgtcaatcattctcgtgttgggcgttgctccc
ccggtccaggcattatctgccgaggaatggaaaaagcaatccgtttataatgttatgacc
gataggtttgctaccagcaaggtcgtacctcattgcgatgtgaaagctgaaaagtactgt
ggaggaaattggcaaggtattgttgatcatcttgactatattcgagatttgggtttcaca
gcgatttctatttctccagtcgttgaacaacttgaaggcccggaatatcatggggaagcc
taccacgggcatagacctaaaaattattaccgtcttaatcctcacttcgggaacgaagag
gacttaaaagagctttcagatgctttgcacggcaaaggcatgtatttgatggtagatgtt
gccataaatcacacaatttcggaatattttgaagacgattatttcaagaatacgtatttc
gataaaactcatattgatcacaaatgcaaggaacattgctcatgccatcacgacaagttc
cctcgcccagttcctcacaatggaaccaagcctgaccataaaccctggaagcacgaggaa
cactgccatcacggtaagttccctcgcccagttcctcataatggaaccaagcctgaccac
aagccttggaagcacgaggaacactgctcatgccatcatgataagttccctcgtccagtt
cctcataatggaaccaagcctgaccataaaccctggaagcacgaggaacactgctcatgc
catcatgataagttccctcgtccagttcctcataatggaaccaagcctgatcataaaccc
tggaagcacgaggaacactgccatcacggtaagtttccccgtccaattcctcacaatgga
accaagcctgaccataaaccctggaagcacgaggaacactgccatcacggtaggttccct
cgtccagttccccacaatggaaccaagcccgatcacaagccatggaagcacgaggaacac
tgctcatgccatcatgataagttctctcgcccagttcctcataatggaaccaagcctgac
cacaaaccttggaagcacgaggaacactgccaccatggtaagttccttcgtccagttcct
cacaatgtaaccaagcctgaccataaaccctggaagcacgaggaacactgccatcacggt
aagttccctcgtccagttccccacaatggaaccaagcccgatcacaagccttggaagcac
gaggaacactgctcttgccatgaagaccattcagttcatgagcgtcctagtgctaaaggg
gctctcgaggactatattcaaacatttgtagaaactttccaaattgatggtattcgtttc
gatgctatgggtgacaaatatagaaagtactggccagatttttgcaaagctgctggagtg
ttttgcatgggtgacttgaaatcttccgactctttaaaagtttgtgattggcaaaacgac
ttggaagggttgagtaacttccctgttagagaatctgctgtaaaagcatttttgatgaat
aatccagagggaattgttgatcttgccgacaaaatgactgacatgcgcggtttgtgtgtc
aatcccctattgttaggaaacttcgttgagaacaaagaccttcctagaatggcttcaatt
tctagtgatccagccaccttaaagaatgcaattgcttttgttcttatgggagatggtatt
cctatgatgtacaacggccaagaacttgccatgcgcggtgaagaggttccttataatcga
cctgcaatttgggagaaaggtttcccaaaaagaaatccttactataagttcacgtctaca
atcaatcgtttccgcaaagctatgattgaaagcaaagacggagaagctttcttaaatatg
cagtcggatattagcatcgttgataaaagaatattgcttttacgacgtggcaaagtaata
accgtactcaacaacttaggttcatattacattcatttccattatactgtttcggcagaa
gagcacaagtggatggacgtattatcttgcaagtccgttccagtacaagataatcgacag
gtatttatggtacgcaacggtgaacccatgatcttgtacccagaggaatcggcttatgag
atgggattgtgcccatctccaattcagcttactgaagattataacagtgaaggttctctc
tccattaacgttgaagaagcccaaacatcaaaggcaccagagcaaaatcgaggatttacc
aatgtcctcgccgctcttttattatctttgttaatgattttgtag

DBGET integrated database retrieval system