KEGG   Schizosaccharomyces pombe (fission yeast): SPBC16A3.15c
Entry
SPBC16A3.15c      CDS       T00076                                 

Gene name
nda2
Definition
(RefSeq) tubulin alpha 1
  KO
K07374  tubulin alpha
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04145  Phagosome
Brite
KEGG Orthology (KO) [BR:spo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    SPBC16A3.15c (nda2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:spo03019]
    SPBC16A3.15c (nda2)
   03036 Chromosome and associated proteins [BR:spo03036]
    SPBC16A3.15c (nda2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:spo04812]
    SPBC16A3.15c (nda2)
   04147 Exosome [BR:spo04147]
    SPBC16A3.15c (nda2)
Messenger RNA biogenesis [BR:spo03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     SPBC16A3.15c (nda2)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     SPBC16A3.15c (nda2)
Cytoskeleton proteins [BR:spo04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    SPBC16A3.15c (nda2)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SPBC16A3.15c (nda2)
  Exosomal proteins of other body fluids (saliva and urine)
   SPBC16A3.15c (nda2)
  Exosomal proteins of colorectal cancer cells
   SPBC16A3.15c (nda2)
SSDB
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Other DBs
NCBI-GeneID: 2539864
NCBI-ProteinID: NP_596774
PomBase: SPBC16A3.15c
UniProt: P04688
Structure
PDB: 
6S8M 5MLV 5MJS

Position
II:join(4268991..4269045,4269136..4270448)
AA seq 455 aa
MREVISVHVGQAGVQIGNACWELYCLEHGIGPDGFPTENSEVHKNNSYLNDGFGTFFSET
GQGKFVPRSIYVDLEPNVIDQVRTGPYKDLFHPEQMVTGKEDASNNYARGHYTVGKEMID
SVLERIRRMADNCSGLQGFLVFHSFGGGTGSGLGALLLERLNMEYGKKSNLQFSVYPAPQ
VSTSVVEPYNSVLTTHATLDNSDCTFMVDNEACYDICRRNLDIERPTYENLNRLIAQVVS
SITASLRFAGSLNVDLNEFQTNLVPYPRIHFPLVTYSPIVSAAKAFHESNSVQEITNQCF
EPYNQMVKCDPRTGRYMATCLLYRGDVIPRDVQAAVTSIKSRRTIQFVDWCPTGFKIGIC
YEPPQHVPGSGIAKVNRAVCMLSNTTSIAEAWSRLDHKFDLMYSKRAFVHWYVGEGMEEG
EFSEAREDLAALERDYEEVGQDSMDNEMYEADEEY
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgagagaagtaatttctgttcatgttggacaagcaggtgttcaaatcggtaacgcatgc
tgggagttgtactgtttggagcatggcataggacccgacggttttcctacagaaaactcc
gaagttcacaaaaacaatagctatttaaatgatggattcggtacatttttttctgaaacc
gggcaaggaaaattcgtacctagaagtatctatgttgatcttgagcctaacgttattgat
caagttcgtactggaccgtataaagatctgtttcatcctgaacagatggtaactggtaag
gaagatgcttctaacaattacgcccgtggacattatactgtaggaaaggaaatgattgat
agtgtattagaaaggatacgtcgtatggctgacaattgttctggtctccaaggtttcctt
gtatttcattcttttggtggtggtaccggctcgggtttgggtgctttacttctggagcgc
ttgaacatggaatacggaaagaaatctaacctccaattttctgtttatcccgcccctcaa
gtgagcacatccgttgttgaaccttacaactctgtgctcactacccatgctactctcgat
aactctgactgtacctttatggttgataatgaggcttgttacgatatctgtcgccgaaat
cttgacattgagcgtccaacctatgaaaacctcaaccgccttattgctcaagttgtctct
tctatcaccgcttctcttcgatttgctggtagcttaaatgttgacttaaatgagtttcaa
actaatcttgtgccataccctcgtattcactttcctttagtcacttattctcctattgtc
agtgcagctaaagcattccatgaatccaacagcgtacaagagattacgaatcagtgcttt
gagccttataatcaaatggtaaaatgtgatccacgaactggccgctatatggctacttgt
cttttgtatcgtggtgatgttatcccacgtgatgtccaggctgccgttactagcattaaa
tctcgtcgcaccatccaatttgttgattggtgccctactggtttcaaaatcggtatttgc
tatgagccaccccaacacgttcctggtagtggaatcgctaaggtaaatcgtgctgtttgt
atgctttcaaataccacctcgattgctgaagcttggtctcgtctggaccacaagtttgac
cttatgtacagcaagcgtgcttttgttcattggtatgtcggtgaaggtatggaagaaggt
gaattttcagaagccagagaagatttggctgccttagaaagggattacgaagaggttggt
caagattctatggataacgaaatgtacgaagctgacgaagagtattaa

DBGET integrated database retrieval system