KEGG   Schizosaccharomyces pombe (fission yeast): SPBC16C6.13c
Entry
SPBC16C6.13c      CDS       T00076                                 
Symbol
sec27
Name
(RefSeq) putative coatomer beta' subunit protein
  KO
K17302  coatomer subunit beta'
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPBC16C6.13c (sec27)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPBC16C6.13c (sec27)
Membrane trafficking [BR:spo04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    SPBC16C6.13c (sec27)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SPBC16C6.13c (sec27)
SSDB
Motif
Pfam: Coatomer_WDAD WD40 NBCH_WD40
Other DBs
NCBI-GeneID: 2540050
NCBI-ProteinID: NP_001342707
PomBase: SPBC16C6.13c
Position
II:complement(join(4354568..4356937,4357000..4357020))
AA seq 796 aa
MMRLDFQRKLLSHTERVKAVDFHPTEPWVIASHYNGQVGIWNYNTQTLVRSFDINDVPIR
ACAFIARKNWFVCGSDDFQVRVYNYNTGEKVTQFEAHPDYIRALVVHPTQPFLLTSSDDM
TIKCFNWDMSWKCVQTFEGHSRYVMSLAINPKDTNTFASSCLDGTVKVWSFGSSVANFTL
QAHDRGVNYVNYYPAGDKPYLITAGDDNLIKVWDYQTKACVRILEGHTNNVSFAFFHSKF
PIIISGSEDGTVKIWHTLSYSLIKSYNFSLDRAWCIAQNKDNGLVTVGFDNGLITFSLGR
DEPSVTMDSSGKVVWSNYNEVMSAMIRPAKEQSDLTDGSLISLSVKELGTTELYPAVLKH
SPNGRFVSVCGNGEYIVYTALAWRNKAYGKALDFAWSADSNVYGSRTSDRSIVIHKNFKE
SNRLDLSYSCDKIFGGFLLGVVGSDFICFYDWDTGILVRKIDVKPKGVYWNDDGRFVILA
CDDDFYLLGFNAEMFYSAVESGTADEEEGVADSFEALADVSESVVNGKWVAETFIYTTTA
ARLNYLIGDQTYKIANVESSFYLLGYIPRDDRIYLTDRDMNVVSYSFNLAIIEYQSLVLK
GDLEAAQGLLEQISETDRPRLSDFLSRLGYKEAALELSGDSVQRFELALDAQRLDIASQI
AQELDDPLKWRSLGDAALNAWDFVLAQECFEKGKDYGSLVLLYTATNNHEGLKELSQLTK
STKINNTAFICSWLTNQPAECVNILTSTQRYPEANLFAATYCPDEVKNVLPEWKVDLTKN
QKERIADSLGDLELKN
NT seq 2391 nt   +upstreamnt  +downstreamnt
atgatgcgactagattttcagagaaagctcttatctcacaccgagcgtgtgaaagcggtt
gattttcatccaacggagccgtgggttatcgcatctcattataatggacaagttggtatt
tggaattacaacactcaaaccttagtacggagttttgacattaatgatgttcctattcgt
gcctgtgcatttattgctagaaaaaactggtttgtttgtggaagtgatgatttccaggtc
cgtgtttacaattataatactggagaaaaagtcacgcagtttgaagcacatccagattac
atccgtgctttagttgtccatcctacccaaccttttttattaacttcctctgatgatatg
accattaaatgcttcaattgggatatgagttggaaatgtgttcaaacatttgagggacat
agccgttatgttatgagccttgccatcaatcccaaagatacaaatacatttgcatcttct
tgccttgacggtactgtcaaagtttggagctttggttcttcagttgccaattttacactt
caagcacatgatcgaggtgtcaattatgtaaactattatcctgccggtgataaaccatac
cttataactgctggagatgacaatcttatcaaagtttgggattatcaaacgaaggcatgt
gtacggattcttgaaggacataccaataatgtctcttttgcatttttccattctaaattt
cctataatcatctctggtagtgaggacggcacagtaaaaatttggcatacgctttcctat
tctctcattaaatcgtataatttttctttagatcgagcttggtgcattgcgcagaataag
gacaatggcttggtaacagtcggttttgacaatggactcataactttctctcttggccgt
gacgagccttctgttactatggattcatcaggaaaagttgtttggtctaactataatgaa
gttatgtccgctatgattagaccggcaaaagagcagagcgatcttacagatggctctctt
atcagtctttctgtgaaagaattgggtactacggaattgtatcctgctgttttgaaacat
tcaccgaatggaagatttgtttccgtatgtggcaatggtgagtatattgtctatacagct
cttgcttggcggaataaagcttatggcaaagcacttgattttgcttggtctgccgattct
aatgtctacggtagtcgtacatcggaccgttcaatcgtaattcacaagaattttaaagaa
agcaatagattagatttgtcctactcttgcgacaagatttttggcggctttctcttggga
gttgtgggaagtgattttatttgcttctatgattgggatactggcattttagttcgtaaa
attgatgttaaacccaaaggagtttattggaatgatgatggcagatttgtaattttagct
tgtgatgatgacttttaccttctcggttttaacgctgaaatgttttatagtgctgtggaa
agtggtacagcagatgaagaggaaggtgttgctgattcctttgaagcacttgctgatgtt
tctgaaagcgtagtaaatggcaaatgggttgctgaaactttcatttacacaactactgcc
gctcgcctaaactacttgatcggtgaccaaacttacaaaatcgctaacgttgaaagtagt
ttttatttgcttggctatattccacgtgacgatcgtatttacctcacggatcgtgatatg
aatgtagtgagctactctttcaaccttgccattattgaatatcaatcactggtactaaag
ggcgatttagaggctgctcaaggtcttttggagcaaatttctgaaacagaccgtcctcgt
ttgtctgactttttgtcccgtttaggatacaaggaagctgcattagagttatctggtgat
tctgtacagcggtttgaacttgcattagacgctcaacgattggatattgcttctcaaatt
gctcaagaattagatgatcctctgaaatggcgttctttgggtgatgctgccttgaatgct
tgggattttgttttagctcaggaatgctttgagaaaggtaaagattatggatctttggtt
ttactttatactgcaaccaacaatcacgagggtctcaaagagttatcgcaactcactaag
tccacaaagataaataatacagctttcatctgctcatggcttacaaatcaaccagcggaa
tgcgtcaatatacttacatctactcaacgttatcctgaagctaacttgtttgctgctact
tactgccctgacgaggttaaaaatgttcttccagaatggaaagttgacttaactaagaat
caaaaagaacgcattgcggattctttgggtgacttggaacttaaaaattaa

DBGET integrated database retrieval system