KEGG   Schizosaccharomyces pombe (fission yeast): SPBC16D10.09
Entry
SPBC16D10.09      CDS       T00076                                 
Symbol
pcn1
Name
(RefSeq) DNA polymerase delta processivity factor
  KO
K04802  proliferating cell nuclear antigen
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03030  DNA replication
spo03410  Base excision repair
spo03420  Nucleotide excision repair
spo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SPBC16D10.09 (pcn1)
   03410 Base excision repair
    SPBC16D10.09 (pcn1)
   03420 Nucleotide excision repair
    SPBC16D10.09 (pcn1)
   03430 Mismatch repair
    SPBC16D10.09 (pcn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spo03032]
    SPBC16D10.09 (pcn1)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPBC16D10.09 (pcn1)
DNA replication proteins [BR:spo03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    SPBC16D10.09 (pcn1)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     SPBC16D10.09 (pcn1)
   MMR (mismatch excision repair)
    Other MMR factors
     SPBC16D10.09 (pcn1)
  TLS (translesion DNA synthesis) factors
   Other TLS factors
    SPBC16D10.09 (pcn1)
SSDB
Motif
Pfam: PCNA_N PCNA_C Rad9 Hus1
Other DBs
NCBI-GeneID: 2540020
NCBI-ProteinID: NP_596504
PomBase: SPBC16D10.09
UniProt: Q03392
Structure
Position
II:3616412..3617845
AA seq 260 aa
MLEARFQQAALLKKLLDAIKELVTDANFDCNDNGISLQAMDSSHVALVSMLIKSDGFEPY
RCDRNIALGINLNALSKVLRCAQNEDLVTLKAEDTPEVLNLVFESEKNDRISDYDVKLMD
IDQEHLGIPDIEYDATITMPAAEFQRITRDLLTLSDSVTINASKEGVRFSCKGDIGNGST
TLKQHTDLSDQDQSIEISLTQAVTLTFSLKYLAQFTKATPLATRVTLSMSNDVPLLVEYK
MESGFLRFYLAPKIGEEDEE
NT seq 783 nt   +upstreamnt  +downstreamnt
atgcttgaagctagatttcagcaggctgctttgttgaaaaagcttctcgatgccatcaag
gagttagttacagatgctaattttgattgcaatgacaacggtatctctctgcaggctatg
gatagttctcatgtagcccttgtttctatgcttattaaatcagatggatttgaaccatat
cggtgtgatagaaatattgctttaggtataaatctgaacgccttatcaaaggtcttacgg
tgtgcccaaaacgaggatttggttactttaaaggctgaagatacacctgaggtattgaat
ttggttttcgagagcgagaaaaatgacaggatctctgattatgatgttaaattaatggac
attgatcaagaacacttgggtataccagatatcgaatacgatgctactattactatgcct
gctgccgaatttcaacgcattactcgagatttattaactttgagtgattcagtaacaatc
aatgctagtaaagagggtgttcgttttagctgcaagggagatattggtaatggtagtacc
acgctgaaacaacataccgatctttctgaccaagatcaaagtatcgaaatttctcttacc
caagctgtaacacttacgttttctttgaaatatttagcccagttcactaaggctactcct
ttagctacccgagtcacactttcaatgagcaatgatgttccacttcttgtggagtataaa
atggaatccggatttttacgattttatcttgccccaaaaattggtgaggaggatgaggag
tag

DBGET integrated database retrieval system