KEGG   Schizosaccharomyces pombe (fission yeast): SPBC16E9.06c
Entry
SPBC16E9.06c      CDS       T00076                                 

Gene name
uvi31
Definition
(RefSeq) BolA domain-containing protein Uvi31
  KO
K22066  BolA-like protein 1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:spo03029]
    SPBC16E9.06c (uvi31)
Mitochondrial biogenesis [BR:spo03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    SPBC16E9.06c (uvi31)
SSDB
Motif
Pfam: BolA
Other DBs
NCBI-GeneID: 2539858
NCBI-ProteinID: NP_595788
PomBase: SPBC16E9.06c
UniProt: Q12238
Position
II:complement(1925686..1925994)
AA seq 102 aa
MIRRFFHTMGRQDRIYKTLSEALKTDKITLYNDSYKHSHHIAMKGVPDTNETHFRLEIVS
PEFSGMSRVARHRLVYGLLKDEFDGGLHALQITSSKTPDEVS
NT seq 309 nt   +upstreamnt  +downstreamnt
atgattagaagattttttcacacaatgggaaggcaggatcgtatttataaaacgctttca
gaagccttgaaaacagacaagattaccttgtataatgatagttataaacatagccatcat
attgcgatgaaaggcgtaccagacacaaatgagactcatttccgtttagaaattgtatca
ccagagttctccgggatgtcaagagtcgcccgacatcgacttgtttatggattactaaaa
gatgaatttgatggcggccttcatgctctccaaataacttctagcaagactcctgatgaa
gtttcgtaa

DBGET integrated database retrieval system