KEGG   Schizosaccharomyces pombe (fission yeast): SPBC16E9.09c
Entry
SPBC16E9.09c      CDS       T00076                                 

Definition
(RefSeq) putative COPII-coated vesicle-associated protein Erp5/Erp6
  KO
K20346  p24 family protein alpha
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPBC16E9.09c
Membrane trafficking [BR:spo04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   p24 family proteins
    SPBC16E9.09c
SSDB
Motif
Pfam: EMP24_GP25L
Other DBs
NCBI-GeneID: 2540028
NCBI-ProteinID: NP_595791
PomBase: SPBC16E9.09c
UniProt: O14324
Position
II:complement(join(1930512..1930540,1930582..1930773,1930835..1931048,1931112..1931324))
AA seq 215 aa
MKLGIFGLLLFTFFFQSQAVHFYFDGSKPKCFLKDMPKGMMVTGIVKAEQWNNEANKWVT
SNNIKIRVQVDETFANNHLIYKNDLRSNEAVRFTTTNEGTHRICYLSTSDGAWFSSTKTR
LHVDLASDDKYNLIASSEDEAKDLTDRVAALNTRLESILGEQMLQRSREMTFRDTSESAN
SRVVRWTIVQIVVLLVTCIWQLSHLQRFFVKEKLV
NT seq 648 nt   +upstreamnt  +downstreamnt
atgaagctgggaattttcggtttattactttttaccttttttttccagtcacaggcagtt
catttttactttgatggatcaaaaccaaaatgtttcctgaaagatatgccgaaaggcatg
atggttactggaattgtgaaggcagagcaatggaacaatgaagcgaacaagtgggtcacc
agtaataacataaaaattcgcgttcaagtcgatgagacctttgctaacaaccatcttatt
tataaaaatgatcttcgctctaatgaagctgtgcgctttactactacaaatgaaggaact
catcgcatctgttatttgtctaccagcgatggagcatggttttcgtctacgaaaacaaga
ttacatgtcgaccttgcttcagatgataaatacaatcttattgcatcctctgaagatgaa
gccaaagatctcaccgacagagttgctgctttgaatacacgcttagaatccatccttggt
gagcaaatgttgcaacgttctcgtgaaatgacttttcgcgatactagtgagagcgcaaat
tctcgtgtcgtccgctggactattgttcaaattgtcgttctcctggttacttgcatatgg
cagctttcccacttacaacgtttcttcgtcaaagagaaattggtttaa

DBGET integrated database retrieval system